Clone IP17683 Report

Search the DGRC for IP17683

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:176
Well:83
Vector:pOT2
Associated Gene/TranscriptCG34221-RB
Protein status:IP17683.pep: gold
Sequenced Size:742

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34221 2008-04-29 Release 5.5 accounting
CG34221 2008-08-15 Release 5.9 accounting
CG34221 2008-12-18 5.12 accounting

Clone Sequence Records

IP17683.complete Sequence

742 bp assembled on 2007-01-15

GenBank Submission: BT030154

> IP17683.complete
CGATGGTTTAACAAAATCCGCACTCTTAATCCAATTAAACAGCGTCGAAA
AAATATATTAAAAAAAAAAAAAAATTACACAAACACACACAAGAAAAACA
ATGCATTTGCCCCAAGGAGCATTAAGCTTTCTGTTCATCACTTGCATGAT
GTTCGCACTGGCAGGCGGCCATCCATCAAGCGACAAGCTGAAGATCCGAA
TACACGTGCCGGTGAAGCACCACACACATGTACACACGAAGACGGTCATT
AAGAAGGTTCCGCTGCCCATTCCGGTGCCGGTCAAGGAGCACCACCACGA
GCCGAAGAAGCACCACAGCAGCCGCAGCCATCACCATCACCACCACCACG
ACGACGACCAGGATGACGATTTCGAGGGCTACGAGTACCCCATCAAGGCC
AAGCGGCGCACGCGGCATCCCTTTGTCTGAGTTCGGGCACAGACCACCCA
ACCACATACGCCGCCCACTCCGCCCAACTCAGCGGGGAAAATGAAATCAA
ATGAAATACAATTTACGCAGATTAAGATGGAAATAAACCAAAATACGAGC
CAGCTTGGCCAGAAAAGGCCGAAAAAAAAACAACACAGAACACAAAGCAA
GAAAAACGCAATCCTGGGTCTGATTTGTCGTCACTGTTTTTAGTGCGTAA
GAGTACAACGTAAAATAAAGAGAGAACCCTTAGATCTAAGTAATCATTTC
AGTGCAATAAAATATACAAAAATTAAAAAAAAAAAAAAAAAA

IP17683.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34221-RB 1075 CG34221-RB 56..780 1..725 3625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6085091..6085620 724..193 2475 98.5 Minus
chr2R 21145070 chr2R 6087112..6087228 119..1 485 95.8 Minus
chr2R 21145070 chr2R 6085912..6085986 193..119 375 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10197548..10198080 725..193 2665 100 Minus
2R 25286936 2R 10199565..10199683 119..1 595 100 Minus
2R 25286936 2R 10198372..10198446 193..119 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10198747..10199279 725..193 2665 100 Minus
2R 25260384 2R 10200764..10200882 119..1 595 100 Minus
2R 25260384 2R 10199571..10199645 193..119 375 100 Minus
Blast to na_te.dros performed 2019-03-16 18:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
hopper 1435 hopper DMTRDNA 1435bp Derived from X80025 (g510507) (Rel. 44, Last updated, Version 11). 144..208 89..26 133 69.2 Minus
Tc1-2 1644 Tc1-2 TC1-2 1644bp 471..522 54..104 131 75 Plus
gypsy5 7369 gypsy5 GYPSY5 7369bp 1662..1746 7..92 112 60.5 Plus

IP17683.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:08:19 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6085913..6085986 119..192 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:13 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 1..330 101..430 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:40 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 1..330 101..430 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:01 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 1..330 101..430 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:22:47 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 1..330 101..430 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:34 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 1..330 101..430 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:41:25 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 9..732 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:40 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 9..732 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:01 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 9..732 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:22:48 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 9..732 1..724 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:34 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34221-RB 29..752 1..724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:19 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10199566..10199683 1..118 100   Minus
2R 10197549..10198080 193..724 100 <- Minus
2R 10198373..10198446 119..192 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:19 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10199566..10199683 1..118 100   Minus
2R 10197549..10198080 193..724 100 <- Minus
2R 10198373..10198446 119..192 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:19 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10199566..10199683 1..118 100   Minus
2R 10197549..10198080 193..724 100 <- Minus
2R 10198373..10198446 119..192 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:01 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6085054..6085585 193..724 100 <- Minus
arm_2R 6085878..6085951 119..192 100 <- Minus
arm_2R 6087071..6087188 1..118 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:44:10 Download gff for IP17683.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10198748..10199279 193..724 100 <- Minus
2R 10199572..10199645 119..192 100 <- Minus
2R 10200765..10200882 1..118 100   Minus

IP17683.hyp Sequence

Translation from 100 to 429

> IP17683.hyp
MHLPQGALSFLFITCMMFALAGGHPSSDKLKIRIHVPVKHHTHVHTKTVI
KKVPLPIPVPVKEHHHEPKKHHSSRSHHHHHHHDDDQDDDFEGYEYPIKA
KRRTRHPFV*

IP17683.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34221-PC 109 CG34221-PC 1..109 1..109 619 100 Plus
CG34221-PB 109 CG34221-PB 1..109 1..109 619 100 Plus

IP17683.pep Sequence

Translation from 100 to 429

> IP17683.pep
MHLPQGALSFLFITCMMFALAGGHPSSDKLKIRIHVPVKHHTHVHTKTVI
KKVPLPIPVPVKEHHHEPKKHHSSRSHHHHHHHDDDQDDDFEGYEYPIKA
KRRTRHPFV*

IP17683.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12135-PA 90 GF12135-PA 1..90 17..109 316 84.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25227-PA 87 GG25227-PA 6..87 27..109 363 92.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20118-PA 110 GH20118-PA 7..110 7..109 421 81 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34221-PC 109 CG34221-PC 1..109 1..109 619 100 Plus
CG34221-PB 109 CG34221-PB 1..109 1..109 619 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20212-PA 92 GI20212-PA 1..92 17..109 330 80.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10488-PA 109 GL10488-PA 1..109 1..109 427 83.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24386-PA 108 GA24386-PA 1..108 1..109 414 84.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20546-PA 88 GM20546-PA 4..88 23..109 262 92 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20162-PA 91 GJ20162-PA 1..91 17..109 329 81.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18020-PA 99 GK18020-PA 1..99 17..109 294 85.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21732-PA 88 GE21732-PA 6..88 27..109 379 94 Plus