Clone IP17726 Report

Search the DGRC for IP17726

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:177
Well:26
Vector:pOT2
Associated Gene/TranscriptCG34174-RA
Protein status:IP17726.pep: gold
Sequenced Size:692

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34174 2008-04-29 Release 5.5 accounting
CG34174 2008-08-15 Release 5.9 accounting
CG34174 2008-12-18 5.12 accounting

Clone Sequence Records

IP17726.complete Sequence

692 bp assembled on 2007-01-15

GenBank Submission: BT030163

> IP17726.complete
AATGACCAAAGCGAATAAAACGCCGCAAAAAGCAAGTGAACCGAATATAA
ATGGTTCCTTCACACCAGTTCGATATTTGGACAGCCAGCGCCTGCAATCG
CCCACGAGTCACGATGCGAATTTAGCCACCTGCAAAACCAGATTGGAAAC
AATAGTCAAACAACTCCAGGATAACTACGCTAAATGGCAGCTGGCCCATC
AGCGGGGCACCTCTATTTGCTATACTATCGAAGCCAAGAAGACCAAGTGT
CTGGAGAAAAGCCAGGATGAAGGCAGCTCCCTTTACCCAGATGATCTCCT
ACTTCCCTGCAACAAGTTGGCCATCATAGCCTCTATTTTCGGGGATATCG
CAAATAATACAAAGGAGATACTAAGACAACTGAGAGGCATATTAAAATTA
CCGGGATCTGCAGCGGATACGATATTCTACAGGTCCTGGAAGTTGCAGCA
ATTCGTGGTTTTCGCGAAGGAGCTATCCGAAAGATATGAGAAGGAGGCTC
TGGTCAAAATGGAAGTTGCCGGTAACATTGCTCACTCGACTGAAAGAAGC
CAGCTCATTGCGCACACAACTTTATGGGAATTTCCCGAGCACGTGGACTC
CTATGTCCATCTGGGGTTTCTTCTCCTTGCCGAAGAAGTCAGTTTAAGGC
AATAAATTAAACAATTTTTCAACTTAAAAAAAAAAAAAAAAA

IP17726.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34174-RA 798 CG34174-RA 124..798 1..675 3375 100 Plus
CG10880.a 1270 CG10880.a 1073..1229 677..521 785 100 Minus
CG10880.b 1312 CG10880.b 1115..1271 677..521 785 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2214167..2214616 75..524 2175 98.9 Plus
chr2L 23010047 chr2L 2214742..2214896 521..675 730 98.1 Plus
chr2L 23010047 chr2L 2214040..2214113 1..74 370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2214438..2214887 75..524 2250 100 Plus
2L 23513712 2L 2215013..2215169 521..677 785 100 Plus
2L 23513712 2L 2214311..2214384 1..74 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2214438..2214887 75..524 2250 100 Plus
2L 23513712 2L 2215013..2215169 521..677 785 100 Plus
2L 23513712 2L 2214311..2214384 1..74 370 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:55:26 has no hits.

IP17726.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:56:06 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2214040..2214113 1..74 100 -> Plus
chr2L 2214167..2214613 75..521 98 -> Plus
chr2L 2214743..2214896 522..675 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:32 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 1..654 2..655 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:11 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 1..654 2..655 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:38 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 1..654 2..655 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:59 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 1..654 2..655 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:20:20 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 1..654 2..655 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:57 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 1..654 2..655 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:11 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 7..681 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:38 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 46..720 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:59 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 1..654 2..655 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:20:20 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
CG34174-RA 46..720 1..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:06 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2214311..2214384 1..74 100 -> Plus
2L 2214438..2214884 75..521 100 -> Plus
2L 2215014..2215167 522..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:06 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2214311..2214384 1..74 100 -> Plus
2L 2214438..2214884 75..521 100 -> Plus
2L 2215014..2215167 522..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:06 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2214311..2214384 1..74 100 -> Plus
2L 2214438..2214884 75..521 100 -> Plus
2L 2215014..2215167 522..675 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:38 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2214311..2214384 1..74 100 -> Plus
arm_2L 2214438..2214884 75..521 100 -> Plus
arm_2L 2215014..2215167 522..675 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:15 Download gff for IP17726.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2214311..2214384 1..74 100 -> Plus
2L 2214438..2214884 75..521 100 -> Plus
2L 2215014..2215167 522..675 100   Plus

IP17726.hyp Sequence

Translation from 0 to 654

> IP17726.hyp
MTKANKTPQKASEPNINGSFTPVRYLDSQRLQSPTSHDANLATCKTRLET
IVKQLQDNYAKWQLAHQRGTSICYTIEAKKTKCLEKSQDEGSSLYPDDLL
LPCNKLAIIASIFGDIANNTKEILRQLRGILKLPGSAADTIFYRSWKLQQ
FVVFAKELSERYEKEALVKMEVAGNIAHSTERSQLIAHTTLWEFPEHVDS
YVHLGFLLLAEEVSLRQ*

IP17726.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34174-PA 217 CG34174-PA 1..217 1..217 1117 100 Plus

IP17726.pep Sequence

Translation from 1 to 654

> IP17726.pep
MTKANKTPQKASEPNINGSFTPVRYLDSQRLQSPTSHDANLATCKTRLET
IVKQLQDNYAKWQLAHQRGTSICYTIEAKKTKCLEKSQDEGSSLYPDDLL
LPCNKLAIIASIFGDIANNTKEILRQLRGILKLPGSAADTIFYRSWKLQQ
FVVFAKELSERYEKEALVKMEVAGNIAHSTERSQLIAHTTLWEFPEHVDS
YVHLGFLLLAEEVSLRQ*

IP17726.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14607-PA 171 GF14607-PA 1..171 1..174 714 75.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24836-PA 217 GG24836-PA 1..217 1..217 1063 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10281-PA 164 GH10281-PA 4..158 16..172 526 62.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34174-PA 217 CG34174-PA 1..217 1..217 1117 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15757-PA 201 GI15757-PA 4..199 16..213 665 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18707-PA 219 GL18707-PA 1..219 1..216 919 77.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25764-PA 219 GA25764-PA 1..219 1..216 903 76.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18320-PA 182 GM18320-PA 1..176 1..176 884 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23136-PA 182 GD23136-PA 1..176 1..176 892 94.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10231-PA 185 GJ10231-PA 1..182 31..213 627 62.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14996-PA 217 GK14996-PA 1..216 1..213 784 68.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18018-PA 216 GE18018-PA 1..216 1..216 1073 93.1 Plus