BDGP Sequence Production Resources |
Search the DGRC for IP17726
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 177 |
Well: | 26 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34174-RA |
Protein status: | IP17726.pep: gold |
Sequenced Size: | 692 |
Gene | Date | Evidence |
---|---|---|
CG34174 | 2008-04-29 | Release 5.5 accounting |
CG34174 | 2008-08-15 | Release 5.9 accounting |
CG34174 | 2008-12-18 | 5.12 accounting |
692 bp assembled on 2007-01-15
GenBank Submission: BT030163
> IP17726.complete AATGACCAAAGCGAATAAAACGCCGCAAAAAGCAAGTGAACCGAATATAA ATGGTTCCTTCACACCAGTTCGATATTTGGACAGCCAGCGCCTGCAATCG CCCACGAGTCACGATGCGAATTTAGCCACCTGCAAAACCAGATTGGAAAC AATAGTCAAACAACTCCAGGATAACTACGCTAAATGGCAGCTGGCCCATC AGCGGGGCACCTCTATTTGCTATACTATCGAAGCCAAGAAGACCAAGTGT CTGGAGAAAAGCCAGGATGAAGGCAGCTCCCTTTACCCAGATGATCTCCT ACTTCCCTGCAACAAGTTGGCCATCATAGCCTCTATTTTCGGGGATATCG CAAATAATACAAAGGAGATACTAAGACAACTGAGAGGCATATTAAAATTA CCGGGATCTGCAGCGGATACGATATTCTACAGGTCCTGGAAGTTGCAGCA ATTCGTGGTTTTCGCGAAGGAGCTATCCGAAAGATATGAGAAGGAGGCTC TGGTCAAAATGGAAGTTGCCGGTAACATTGCTCACTCGACTGAAAGAAGC CAGCTCATTGCGCACACAACTTTATGGGAATTTCCCGAGCACGTGGACTC CTATGTCCATCTGGGGTTTCTTCTCCTTGCCGAAGAAGTCAGTTTAAGGC AATAAATTAAACAATTTTTCAACTTAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 2214167..2214616 | 75..524 | 2175 | 98.9 | Plus |
chr2L | 23010047 | chr2L | 2214742..2214896 | 521..675 | 730 | 98.1 | Plus |
chr2L | 23010047 | chr2L | 2214040..2214113 | 1..74 | 370 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 2214040..2214113 | 1..74 | 100 | -> | Plus |
chr2L | 2214167..2214613 | 75..521 | 98 | -> | Plus |
chr2L | 2214743..2214896 | 522..675 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 1..654 | 2..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 1..654 | 2..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 1..654 | 2..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 1..654 | 2..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 1..654 | 2..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 1..654 | 2..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 7..681 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 46..720 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 1..654 | 2..655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34174-RA | 46..720 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2214311..2214384 | 1..74 | 100 | -> | Plus |
2L | 2214438..2214884 | 75..521 | 100 | -> | Plus |
2L | 2215014..2215167 | 522..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2214311..2214384 | 1..74 | 100 | -> | Plus |
2L | 2214438..2214884 | 75..521 | 100 | -> | Plus |
2L | 2215014..2215167 | 522..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2214311..2214384 | 1..74 | 100 | -> | Plus |
2L | 2214438..2214884 | 75..521 | 100 | -> | Plus |
2L | 2215014..2215167 | 522..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 2214311..2214384 | 1..74 | 100 | -> | Plus |
arm_2L | 2214438..2214884 | 75..521 | 100 | -> | Plus |
arm_2L | 2215014..2215167 | 522..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2214311..2214384 | 1..74 | 100 | -> | Plus |
2L | 2214438..2214884 | 75..521 | 100 | -> | Plus |
2L | 2215014..2215167 | 522..675 | 100 | Plus |
Translation from 0 to 654
> IP17726.hyp MTKANKTPQKASEPNINGSFTPVRYLDSQRLQSPTSHDANLATCKTRLET IVKQLQDNYAKWQLAHQRGTSICYTIEAKKTKCLEKSQDEGSSLYPDDLL LPCNKLAIIASIFGDIANNTKEILRQLRGILKLPGSAADTIFYRSWKLQQ FVVFAKELSERYEKEALVKMEVAGNIAHSTERSQLIAHTTLWEFPEHVDS YVHLGFLLLAEEVSLRQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34174-PA | 217 | CG34174-PA | 1..217 | 1..217 | 1117 | 100 | Plus |
Translation from 1 to 654
> IP17726.pep MTKANKTPQKASEPNINGSFTPVRYLDSQRLQSPTSHDANLATCKTRLET IVKQLQDNYAKWQLAHQRGTSICYTIEAKKTKCLEKSQDEGSSLYPDDLL LPCNKLAIIASIFGDIANNTKEILRQLRGILKLPGSAADTIFYRSWKLQQ FVVFAKELSERYEKEALVKMEVAGNIAHSTERSQLIAHTTLWEFPEHVDS YVHLGFLLLAEEVSLRQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14607-PA | 171 | GF14607-PA | 1..171 | 1..174 | 714 | 75.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24836-PA | 217 | GG24836-PA | 1..217 | 1..217 | 1063 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10281-PA | 164 | GH10281-PA | 4..158 | 16..172 | 526 | 62.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34174-PA | 217 | CG34174-PA | 1..217 | 1..217 | 1117 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15757-PA | 201 | GI15757-PA | 4..199 | 16..213 | 665 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18707-PA | 219 | GL18707-PA | 1..219 | 1..216 | 919 | 77.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25764-PA | 219 | GA25764-PA | 1..219 | 1..216 | 903 | 76.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18320-PA | 182 | GM18320-PA | 1..176 | 1..176 | 884 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23136-PA | 182 | GD23136-PA | 1..176 | 1..176 | 892 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10231-PA | 185 | GJ10231-PA | 1..182 | 31..213 | 627 | 62.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14996-PA | 217 | GK14996-PA | 1..216 | 1..213 | 784 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18018-PA | 216 | GE18018-PA | 1..216 | 1..216 | 1073 | 93.1 | Plus |