Clone IP17767 Report

Search the DGRC for IP17767

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:177
Well:67
Vector:pOT2
Associated Gene/TranscriptCG34204-RA
Protein status:IP17767.pep: gold
Sequenced Size:450

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34204 2008-04-29 Release 5.5 accounting
CG34204 2008-08-15 Release 5.9 accounting
CG34204 2008-12-18 5.12 accounting

Clone Sequence Records

IP17767.complete Sequence

450 bp assembled on 2007-01-15

GenBank Submission: BT030169

> IP17767.complete
ATAGCTTCAAAACTAGTAACTCCAAATCTGAAAATCCCGTTTAAACCCAT
TTTCTCTGCGACTAATTACAGTAGCGCTCCATCGGTAAAATGCCGGTGGC
TGTACGTCTAGTAGAGGTCTTGACCCTGATCACCATTATGGGTCTAATTA
CATGCATTGGTCTCAGCGTGATTTTGGCCCAAAAGACACTCAGTATGACA
ATAACATTTCTCGAGCCCGCAGCGAATATTGCCAATATGGTGCTAGTTGT
AACCGAGAAAATACTGGTGTCCTCGCTGCTCTGCGTTTTGAGTCTCACAA
ATGCGGTGGGAAATGCCCTGCATGTGGCTGGAATCGCCTGATGATCTATA
TCTTACTATATATATATCAAACTTTTTCTGATCAATGTTATGTCTCATAT
ACTAATATATTGCTCGCCGCACGTTTTATTAAAAAAAAAAAAAAAAAAAA

IP17767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34204-RA 621 CG34204-RA 135..565 1..431 2155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17682846..17683058 1..215 995 98.6 Plus
chr2R 21145070 chr2R 17683118..17683294 214..390 885 100 Plus
chr2R 21145070 chr2R 17683311..17683351 390..430 190 97.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21796725..21796942 214..431 1090 100 Plus
2R 25286936 2R 21796451..21796665 1..215 1075 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21797924..21798141 214..431 1090 100 Plus
2R 25260384 2R 21797650..21797864 1..215 1075 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:12:25 has no hits.

IP17767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:13:13 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17682846..17683058 1..215 98 -> Plus
chr2R 17683120..17683291 216..387 100 <- Plus
chr2R 17683308..17683351 388..430 93   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:48 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 1..252 90..341 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:15 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 1..252 90..341 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:42 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 1..252 90..341 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:28 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 1..252 90..341 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:15 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 1..252 90..341 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:32 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 1..252 90..341 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:15 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 1..430 1..430 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:42 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 57..486 1..430 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:15 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
CG34204-RA 57..486 1..430 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:13 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21796451..21796665 1..215 100 -> Plus
2R 21796727..21796941 216..430 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:13 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21796451..21796665 1..215 100 -> Plus
2R 21796727..21796941 216..430 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:13 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21796451..21796665 1..215 100 -> Plus
2R 21796727..21796941 216..430 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:42 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17683956..17684170 1..215 100 -> Plus
arm_2R 17684232..17684446 216..430 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:56 Download gff for IP17767.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21797650..21797864 1..215 100 -> Plus
2R 21797926..21798140 216..430 100   Plus

IP17767.pep Sequence

Translation from 89 to 340

> IP17767.pep
MPVAVRLVEVLTLITIMGLITCIGLSVILAQKTLSMTITFLEPAANIANM
VLVVTEKILVSSLLCVLSLTNAVGNALHVAGIA*

IP17767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13271-PA 83 GF13271-PA 1..83 1..83 310 78.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22142-PA 83 GG22142-PA 1..83 1..83 355 88 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34204-PA 83 CG34204-PA 1..83 1..83 389 100 Plus
CG34204-PB 49 CG34204-PB 1..42 1..42 196 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16953-PA 83 GL16953-PA 1..83 1..83 225 57.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25000-PA 83 GA25000-PA 1..83 1..83 225 57.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15868-PA 83 GM15868-PA 1..83 1..83 378 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11629-PA 83 GD11629-PA 1..83 1..83 383 96.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15927-PA 83 GK15927-PA 1..83 1..83 247 59 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12223-PA 83 GE12223-PA 1..83 1..83 347 85.5 Plus

IP17767.hyp Sequence

Translation from 151 to 430

> IP17767.hyp
MHWSQRDFGPKDTQYDNNISRARSEYCQYGASCNRENTGVLAALRFESHK
CGGKCPACGWNRLMIYILLYIYQTFSDQCYVSYTNILLAARFI
Sequence IP17767.hyp has no blast hits.