IP17767.complete Sequence
450 bp assembled on 2007-01-15
GenBank Submission: BT030169
> IP17767.complete
ATAGCTTCAAAACTAGTAACTCCAAATCTGAAAATCCCGTTTAAACCCAT
TTTCTCTGCGACTAATTACAGTAGCGCTCCATCGGTAAAATGCCGGTGGC
TGTACGTCTAGTAGAGGTCTTGACCCTGATCACCATTATGGGTCTAATTA
CATGCATTGGTCTCAGCGTGATTTTGGCCCAAAAGACACTCAGTATGACA
ATAACATTTCTCGAGCCCGCAGCGAATATTGCCAATATGGTGCTAGTTGT
AACCGAGAAAATACTGGTGTCCTCGCTGCTCTGCGTTTTGAGTCTCACAA
ATGCGGTGGGAAATGCCCTGCATGTGGCTGGAATCGCCTGATGATCTATA
TCTTACTATATATATATCAAACTTTTTCTGATCAATGTTATGTCTCATAT
ACTAATATATTGCTCGCCGCACGTTTTATTAAAAAAAAAAAAAAAAAAAA
IP17767.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34204-RA | 621 | CG34204-RA | 135..565 | 1..431 | 2155 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:12:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 17682846..17683058 | 1..215 | 995 | 98.6 | Plus |
chr2R | 21145070 | chr2R | 17683118..17683294 | 214..390 | 885 | 100 | Plus |
chr2R | 21145070 | chr2R | 17683311..17683351 | 390..430 | 190 | 97.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:12:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 21796725..21796942 | 214..431 | 1090 | 100 | Plus |
2R | 25286936 | 2R | 21796451..21796665 | 1..215 | 1075 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 21797924..21798141 | 214..431 | 1090 | 100 | Plus |
2R | 25260384 | 2R | 21797650..21797864 | 1..215 | 1075 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 18:12:25 has no hits.
IP17767.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:13:13 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 17682846..17683058 | 1..215 | 98 | -> | Plus |
chr2R | 17683120..17683291 | 216..387 | 100 | <- | Plus |
chr2R | 17683308..17683351 | 388..430 | 93 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:48 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 1..252 | 90..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:15 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 1..252 | 90..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:42 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 1..252 | 90..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:28 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 1..252 | 90..341 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:15 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 1..252 | 90..341 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:32 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 1..252 | 90..341 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:15 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 1..430 | 1..430 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:42 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 57..486 | 1..430 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:15 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34204-RA | 57..486 | 1..430 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:13 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 21796451..21796665 | 1..215 | 100 | -> | Plus |
2R | 21796727..21796941 | 216..430 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:13 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 21796451..21796665 | 1..215 | 100 | -> | Plus |
2R | 21796727..21796941 | 216..430 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:13 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 21796451..21796665 | 1..215 | 100 | -> | Plus |
2R | 21796727..21796941 | 216..430 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:42 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 17683956..17684170 | 1..215 | 100 | -> | Plus |
arm_2R | 17684232..17684446 | 216..430 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:56 Download gff for
IP17767.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 21797650..21797864 | 1..215 | 100 | -> | Plus |
2R | 21797926..21798140 | 216..430 | 100 | | Plus |
IP17767.pep Sequence
Translation from 89 to 340
> IP17767.pep
MPVAVRLVEVLTLITIMGLITCIGLSVILAQKTLSMTITFLEPAANIANM
VLVVTEKILVSSLLCVLSLTNAVGNALHVAGIA*
IP17767.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:05:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13271-PA | 83 | GF13271-PA | 1..83 | 1..83 | 310 | 78.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:05:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22142-PA | 83 | GG22142-PA | 1..83 | 1..83 | 355 | 88 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34204-PA | 83 | CG34204-PA | 1..83 | 1..83 | 389 | 100 | Plus |
CG34204-PB | 49 | CG34204-PB | 1..42 | 1..42 | 196 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:05:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL16953-PA | 83 | GL16953-PA | 1..83 | 1..83 | 225 | 57.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:05:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25000-PA | 83 | GA25000-PA | 1..83 | 1..83 | 225 | 57.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:05:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15868-PA | 83 | GM15868-PA | 1..83 | 1..83 | 378 | 95.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:05:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11629-PA | 83 | GD11629-PA | 1..83 | 1..83 | 383 | 96.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:05:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK15927-PA | 83 | GK15927-PA | 1..83 | 1..83 | 247 | 59 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:05:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12223-PA | 83 | GE12223-PA | 1..83 | 1..83 | 347 | 85.5 | Plus |
IP17767.hyp Sequence
Translation from 151 to 430
> IP17767.hyp
MHWSQRDFGPKDTQYDNNISRARSEYCQYGASCNRENTGVLAALRFESHK
CGGKCPACGWNRLMIYILLYIYQTFSDQCYVSYTNILLAARFI
Sequence IP17767.hyp has no blast hits.