Clone IP17771 Report

Search the DGRC for IP17771

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:177
Well:71
Vector:pOT2
Associated Gene/TranscriptCG34213-RA
Protein status:IP17771.pep: gold
Sequenced Size:511

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34213 2008-04-29 Release 5.5 accounting
CG34213 2008-08-15 Release 5.9 accounting
CG34213 2008-12-18 5.12 accounting

Clone Sequence Records

IP17771.complete Sequence

511 bp assembled on 2007-01-15

GenBank Submission: BT030170

> IP17771.complete
ATTTCTTATTTTTATTGAATTATGAATATTTTGACAAAAGTAAAATACAG
CTGCAGGGTGAGCTCGGTTTTAAACAGAGATGTGAAGCAGCACGGAAAGC
AATTCATGTTTGATACGCGGGAAGAAACTTCTTGGAATTCAGATGAGGGA
ACCCCCCAATTCATTACCATTAGCTTGGAGGAGCCACAGAAAGTAGCTGG
ATTTAGTTTCCAGTTCCAAGGCGGATTCTCTGGCCAAAAATCCGAACTGA
TCATGTACTCCGCTGACGGAGCCCAAGTTCACCAAGAGCCATTCTACCCA
GAAGATATCAACTCCCCACAGCTTTTTCAGATTGCGGAATCAGTCCGGGA
AAACCCCTGCTCAAAGCTAAAGTTCGTCTTCGAGTCCAGCACCGATCTAT
TTGGTAGAATCATTGTTTACGATCTCCAGCTGTTCGGCTAGTCTCTGACC
CAATAGATCTTACTAAATGTGTACAAAATCTTCTCTAAAAAAAAAAAAAA
AAAAAAAAAAA

IP17771.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34213-RA 651 CG34213-RA 36..523 1..488 2440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19853203..19853543 486..146 1675 99.4 Minus
chr2R 21145070 chr2R 19853594..19853690 148..52 485 100 Minus
chr2R 21145070 chr2R 19853736..19853792 57..1 285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23967122..23967464 488..146 1715 100 Minus
2R 25286936 2R 23967515..23967611 148..52 485 100 Minus
2R 25286936 2R 23967657..23967713 57..1 285 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23968321..23968663 488..146 1715 100 Minus
2R 25260384 2R 23968714..23968810 148..52 485 100 Minus
2R 25260384 2R 23968856..23968912 57..1 285 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:56:51 has no hits.

IP17771.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:57:39 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19853203..19853541 148..486 99 <- Minus
chr2R 19853595..19853685 57..147 100 <- Minus
chr2R 19853737..19853792 1..56 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:52 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:34 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:46:53 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:45 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:41 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 1..420 22..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:47 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:34 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 4..489 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:53 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 33..518 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:45 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:41 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
CG34213-RA 33..518 1..486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:39 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23967124..23967462 148..486 100 <- Minus
2R 23967516..23967606 57..147 100 <- Minus
2R 23967658..23967713 1..56 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:39 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23967124..23967462 148..486 100 <- Minus
2R 23967516..23967606 57..147 100 <- Minus
2R 23967658..23967713 1..56 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:39 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23967124..23967462 148..486 100 <- Minus
2R 23967516..23967606 57..147 100 <- Minus
2R 23967658..23967713 1..56 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:53 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19854647..19854985 148..486 100 <- Minus
arm_2R 19855039..19855129 57..147 100 <- Minus
arm_2R 19855181..19855236 1..56 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:07 Download gff for IP17771.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23968341..23968679 148..486 100 <- Minus
2R 23968733..23968823 57..147 100 <- Minus
2R 23968875..23968930 1..56 100   Minus

IP17771.pep Sequence

Translation from 21 to 440

> IP17771.pep
MNILTKVKYSCRVSSVLNRDVKQHGKQFMFDTREETSWNSDEGTPQFITI
SLEEPQKVAGFSFQFQGGFSGQKSELIMYSADGAQVHQEPFYPEDINSPQ
LFQIAESVRENPCSKLKFVFESSTDLFGRIIVYDLQLFG*

IP17771.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34213-PA 139 CG34213-PA 1..139 1..139 724 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11505-PA 90 GE11505-PA 1..90 50..139 411 84.4 Plus

IP17771.hyp Sequence

Translation from 21 to 440

> IP17771.hyp
MNILTKVKYSCRVSSVLNRDVKQHGKQFMFDTREETSWNSDEGTPQFITI
SLEEPQKVAGFSFQFQGGFSGQKSELIMYSADGAQVHQEPFYPEDINSPQ
LFQIAESVRENPCSKLKFVFESSTDLFGRIIVYDLQLFG*

IP17771.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34213-PA 139 CG34213-PA 1..139 1..139 724 100 Plus