Clone IP17782 Report

Search the DGRC for IP17782

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:177
Well:82
Vector:pOT2
Associated Gene/TranscriptPka-R2-RD
Protein status:IP17782.pep: gold
Sequenced Size:1434

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Pka-R2 2008-04-29 Release 5.5 accounting
Pka-R2 2008-08-15 Release 5.9 accounting
Pka-R2 2008-12-18 5.12 accounting

Clone Sequence Records

IP17782.complete Sequence

1434 bp assembled on 2007-01-17

GenBank Submission: BT029963

> IP17782.complete
AAACAACAAAAGCAAGCTAAGGAACAAGGCAAAAAAAGTCAGCGAAGAAA
GAGACGGAGGAGCAGGTGAAACAGGTGGACGCAGGAGACCCACCCACCCG
AAAGAAACTATCACCACCAGCAGGTGACAGCAAAGCAGCAGAAAGTCAGC
ACAAATATGTCGAGCGATTCGAGTCGAAGGATCCAGGTGCCCGAGGAGCT
GAAGGAGGTGCTGCTGCAGTTCTCGATCTCCTTTCTGGTGGAACAACCGC
CGGATGTGATCGATTACGCTGTGGAGTACTTCACCAAACTGCAGTCGGAA
CGCCCGAGCGTCTCTCACACGGATCAAAGCACCGATGACCAGCTGAGCGT
CAACTCACAGGATGCCGATGCGGAACCACCAGTGATGGCCAGCTCGCGTC
GCAAATCAGTTTTCGCCGAGGCCTACGATCCGGAGGCGGATGACGACGAT
GATGGCGCCACCGCCGTGTTCCCCAAGACAGATGAGCAGCGCGCCCGGCT
GGTCGAGTCGGTGAAGAACGTCCTCCTCTTCCGATCCCTCGAGAAGGAGC
AGATGAACCAAGTCCTGGATGCCATGTTCGAGCGAAAGGTTCAGCCGGGT
GACTTTATCATCCGCCAGGGTGACGACGGCGATAACTTTTATGTTATTGA
ATCTGGCGTCTACAAAGTCTATATTAATGACAAGCACATTAACACCTACA
ATCACACTGGACTCTTCGGTGAATTAGCGCTGCTCTACAATATGCCCAGA
GCGGCCACCGTGCAGGCGGAAACGAGTGGTCTACTTTGGGCCATGGATCG
CCAGACCTTCCGCCGCATCCTCTTGAAGTCGGCCTTCAGGAAGCGGAAAA
TGTACGAGGAGCTGTTGAACAGCGTGCCCATGCTGAAGGCCTTGCAGAAC
TACGAACGCATGAATCTGGCGGATGCCTTGGTTTCGAAGAGCTACGACAA
TGGCGAACGCATCATCAAACAGGGTGACGCCGCCGACGGCATGTACTTCA
TTGAGGAGGGAACGGTGTCCGTGCGCATGGACCAGGACGACGCCGAGGTG
GAGATCTCCCAGCTGGGCAAGGGACAGTACTTCGGCGAGCTGGCGCTGGT
GACACATCGACCCCGGGCAGCATCCGTCTACGCCACGGGCGGCGTCGTCA
AGCTAGCATTCCTAGACACAGAGGCCTTTGAGCGCATCATGGGCTTCCTG
ACCGATGTACTCAAGCGCAATATCGTGATCTATGAGCAAATGTTCACCGA
CATGGCCCGCCGTAATACGAATTTGTGAAGAAATCAGTTTGAAGCGTTCT
TATTTGTATAGTTTATTTTATTCCAAATTTGCAATTGTACCATATACCAT
CATTCAAATCAAACCAGAGCTATACAAAATTTAAGAAAGTAAATAAAGCC
AGTTTCGTTCCGACACACAAAAAAAAAAAAAAAA

IP17782.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Pka-R2.m 1973 Pka-R2.m 211..1373 1..1163 5815 100 Plus
Pka-R2.l 2110 Pka-R2.l 306..1468 1..1163 5815 100 Plus
Pka-R2-RE 2095 Pka-R2-RE 347..1509 1..1163 5815 100 Plus
Pka-R2.m 1973 Pka-R2.m 1701..1960 1160..1419 1300 100 Plus
Pka-R2.l 2110 Pka-R2.l 1796..2055 1160..1419 1300 100 Plus
Pka-R2-RE 2095 Pka-R2-RE 1837..2095 1160..1418 1295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5884470..5884728 1418..1160 1295 100 Minus
chr2R 21145070 chr2R 5892653..5892876 370..147 1120 100 Minus
chr2R 21145070 chr2R 5885212..5885398 1159..973 935 100 Minus
chr2R 21145070 chr2R 5887240..5887422 552..370 915 100 Minus
chr2R 21145070 chr2R 5885920..5886069 897..748 750 100 Minus
chr2R 21145070 chr2R 5911567..5911715 149..1 715 98.7 Minus
chr2R 21145070 chr2R 5886932..5887036 653..549 525 100 Minus
chr2R 21145070 chr2R 5886212..5886307 749..654 480 100 Minus
chr2R 21145070 chr2R 5885774..5885854 975..895 405 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9996961..9997220 1419..1160 1300 100 Minus
2R 25286936 2R 10005157..10005380 370..147 1120 100 Minus
2R 25286936 2R 9997704..9997890 1159..973 935 100 Minus
2R 25286936 2R 9999734..9999916 552..370 915 100 Minus
2R 25286936 2R 9998415..9998564 897..748 750 100 Minus
2R 25286936 2R 10024051..10024199 149..1 745 100 Minus
2R 25286936 2R 9999425..9999529 653..549 525 100 Minus
2R 25286936 2R 9998707..9998802 749..654 480 100 Minus
2R 25286936 2R 9998269..9998349 975..895 405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9998160..9998419 1419..1160 1300 100 Minus
2R 25260384 2R 10006356..10006579 370..147 1120 100 Minus
2R 25260384 2R 9998903..9999089 1159..973 935 100 Minus
2R 25260384 2R 10000933..10001115 552..370 915 100 Minus
2R 25260384 2R 9999614..9999763 897..748 750 100 Minus
2R 25260384 2R 10025250..10025398 149..1 745 100 Minus
2R 25260384 2R 10000624..10000728 653..549 525 100 Minus
2R 25260384 2R 9999906..10000001 749..654 480 100 Minus
2R 25260384 2R 9999468..9999548 975..895 405 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:51:29 has no hits.

IP17782.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:52:41 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5885212..5885397 974..1159 100 <- Minus
chr2R 5885776..5885851 898..973 100 <- Minus
chr2R 5885920..5886067 750..897 100 <- Minus
chr2R 5886212..5886307 654..749 100 <- Minus
chr2R 5886932..5887032 553..653 100 <- Minus
chr2R 5887240..5887421 371..552 100 <- Minus
chr2R 5892653..5892873 150..370 100 <- Minus
chr2R 5911567..5911715 1..149 98   Minus
chr2R 5884470..5884728 1160..1418 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:45:13 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 1..1122 157..1278 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:09:13 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 1..1122 157..1278 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:51:20 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 1..1122 157..1278 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:19:28 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 1..1122 157..1278 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:12:27 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 1..1122 157..1278 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:45:12 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 190..1467 1..1278 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:09:13 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 190..1607 1..1418 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:51:20 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 197..1614 1..1418 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:19:28 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 190..1467 1..1278 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:12:27 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
Pka-R2-RD 197..1614 1..1418 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:52:41 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9996962..9997220 1160..1418 100 <- Minus
2R 9997704..9997889 974..1159 100 <- Minus
2R 9998271..9998346 898..973 100 <- Minus
2R 9998415..9998562 750..897 100 <- Minus
2R 9998707..9998802 654..749 100 <- Minus
2R 9999425..9999525 553..653 100 <- Minus
2R 9999734..9999915 371..552 100 <- Minus
2R 10005157..10005377 150..370 100 <- Minus
2R 10024051..10024199 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:52:41 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9996962..9997220 1160..1418 100 <- Minus
2R 9997704..9997889 974..1159 100 <- Minus
2R 9998271..9998346 898..973 100 <- Minus
2R 9998415..9998562 750..897 100 <- Minus
2R 9998707..9998802 654..749 100 <- Minus
2R 9999425..9999525 553..653 100 <- Minus
2R 9999734..9999915 371..552 100 <- Minus
2R 10005157..10005377 150..370 100 <- Minus
2R 10024051..10024199 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:52:41 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9996962..9997220 1160..1418 100 <- Minus
2R 9997704..9997889 974..1159 100 <- Minus
2R 9998271..9998346 898..973 100 <- Minus
2R 9998415..9998562 750..897 100 <- Minus
2R 9998707..9998802 654..749 100 <- Minus
2R 9999425..9999525 553..653 100 <- Minus
2R 9999734..9999915 371..552 100 <- Minus
2R 10005157..10005377 150..370 100 <- Minus
2R 10024051..10024199 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:51:20 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5884467..5884725 1160..1418 100 <- Minus
arm_2R 5885209..5885394 974..1159 100 <- Minus
arm_2R 5885776..5885851 898..973 100 <- Minus
arm_2R 5885920..5886067 750..897 100 <- Minus
arm_2R 5886212..5886307 654..749 100 <- Minus
arm_2R 5886930..5887030 553..653 100 <- Minus
arm_2R 5887239..5887420 371..552 100 <- Minus
arm_2R 5892662..5892882 150..370 100 <- Minus
arm_2R 5911556..5911704 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:41:45 Download gff for IP17782.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9998903..9999088 974..1159 100 <- Minus
2R 9999470..9999545 898..973 100 <- Minus
2R 9999614..9999761 750..897 100 <- Minus
2R 9999906..10000001 654..749 100 <- Minus
2R 10000624..10000724 553..653 100 <- Minus
2R 10000933..10001114 371..552 100 <- Minus
2R 10006356..10006576 150..370 100 <- Minus
2R 10025250..10025398 1..149 100   Minus
2R 9998161..9998419 1160..1418 100 <- Minus

IP17782.pep Sequence

Translation from 156 to 1277

> IP17782.pep
MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERP
SVSHTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDG
ATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDF
IIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAA
TVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYE
RMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEI
SQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDTEAFERIMGFLTD
VLKRNIVIYEQMFTDMARRNTNL*

IP17782.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13729-PA 376 GF13729-PA 1..372 1..373 1737 89.5 Plus
Dana\GF24284-PA 321 GF24284-PA 16..318 58..364 595 41.7 Plus
Dana\GF14659-PA 1076 GF14659-PA 486..741 105..354 359 33.6 Plus
Dana\GF15745-PA 1020 GF15745-PA 428..674 105..348 348 34 Plus
Dana\GF14873-PA 780 GF14873-PA 145..429 75..355 338 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25241-PA 410 GG25241-PA 1..367 1..367 1941 99.7 Plus
Dere\GG16143-PA 321 GG16143-PA 16..318 58..364 599 42.1 Plus
Dere\GG24630-PA 768 GG24630-PA 185..420 124..355 330 29.7 Plus
Dere\GG10087-PA 1008 GG10087-PA 433..662 120..348 321 32.6 Plus
Dere\GG24420-PA 1319 GG24420-PA 792..984 165..354 279 32.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21613-PA 376 GH21613-PA 1..372 1..373 1689 83.6 Plus
Dgri\GH25304-PA 186 GH25304-PA 1..179 95..273 910 93.3 Plus
Dgri\GH15909-PA 376 GH15909-PA 26..368 15..359 621 39.3 Plus
Dgri\GH10498-PA 766 GH10498-PA 135..418 75..355 362 27.2 Plus
Dgri\GH11077-PA 1048 GH11077-PA 475..703 121..348 347 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
Pka-R2-PD 373 CG15862-PD 1..373 1..373 1885 100 Plus
Pka-R2-PB 377 CG15862-PB 1..373 1..373 1769 93.8 Plus
Pka-R2-PA 377 CG15862-PA 1..373 1..373 1769 93.8 Plus
Pka-R2-PE 376 CG15862-PE 1..373 1..373 1744 93.3 Plus
Pka-R1-PAC 377 CG42341-PAC 26..369 15..359 614 40.3 Plus
Pka-R1-PAB 377 CG42341-PAB 26..369 15..359 614 40.3 Plus
Pka-R1-PAA 377 CG42341-PAA 26..369 15..359 614 40.3 Plus
Pka-R1-PU 376 CG42341-PU 26..368 15..359 612 40.1 Plus
Pka-R1-PT 376 CG42341-PT 26..368 15..359 612 40.1 Plus
Pka-R1-PP 376 CG42341-PP 26..368 15..359 612 40.1 Plus
Pka-R1-PM 376 CG42341-PM 26..368 15..359 612 40.1 Plus
Pka-R1-PL 376 CG3263-PJ 26..368 15..359 612 40.1 Plus
Pka-R1-PK 376 CG3263-PI 26..368 15..359 612 40.1 Plus
Pka-R1-PV 464 CG42341-PV 110..456 11..359 582 39.7 Plus
Pka-R1-PZ 320 CG42341-PZ 14..312 58..359 581 43 Plus
Pka-R1-PW 322 CG42341-PW 16..314 58..359 581 43 Plus
Pka-R1-PO 463 CG42341-PO 110..455 11..359 580 39.5 Plus
Pka-R1-PR 319 CG42341-PR 14..311 58..359 579 42.8 Plus
Pka-R1-PQ 321 CG42341-PQ 16..313 58..359 579 42.8 Plus
Pka-R1-PX 297 CG42341-PX 5..289 72..359 574 44 Plus
Pka-R1-PS 296 CG42341-PS 5..288 72..359 572 43.8 Plus
Pka-R1-PN 296 CG42341-PN 5..288 72..359 572 43.8 Plus
for-PL 742 CG10033-PL 152..407 105..354 353 32.9 Plus
for-PA 1088 CG10033-PA 498..753 105..354 353 32.9 Plus
for-PI 1088 CG10033-PI 498..753 105..354 353 32.9 Plus
for-PH 1088 CG10033-PH 498..753 105..354 353 32.9 Plus
CG4839-PA 1003 CG4839-PA 324..663 31..354 343 26.5 Plus
CG4839-PB 1003 CG4839-PB 324..663 31..354 343 26.5 Plus
for-PN 568 CG10033-PN 2..233 126..354 341 32.8 Plus
for-PM 568 CG10033-PM 2..233 126..354 341 32.8 Plus
Pkg21D-PA 768 CG3324-PA 114..420 50..355 336 26.1 Plus
for-PJ 934 CG10033-PJ 386..599 150..354 277 31.8 Plus
for-PE 934 CG10033-PE 386..599 150..354 277 31.8 Plus
for-PK 894 CG10033-PK 356..559 154..354 275 31.9 Plus
for-PG 894 CG10033-PG 356..559 154..354 275 31.9 Plus
for-PD 894 CG10033-PD 356..559 154..354 275 31.9 Plus
for-PC 894 CG10033-PC 356..559 154..354 275 31.9 Plus
for-PO 471 CG10033-PO 1..136 222..354 166 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20066-PA 377 GI20066-PA 1..373 1..373 1659 83.6 Plus
Dmoj\GI16562-PA 407 GI16562-PA 116..404 72..364 594 42.7 Plus
Dmoj\GI17596-PA 1027 GI17596-PA 439..682 107..348 354 33.2 Plus
Dmoj\GI17764-PA 1111 GI17764-PA 521..776 105..354 351 33.2 Plus
Dmoj\GI18016-PA 484 GI18016-PA 14..136 236..355 179 35 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10567-PA 372 GL10567-PA 1..372 1..373 1809 90.1 Plus
Dper\GL24352-PA 377 GL24352-PA 27..369 15..359 630 39.8 Plus
Dper\GL15340-PA 768 GL15340-PA 182..416 124..355 356 30.6 Plus
Dper\GL18962-PA 1002 GL18962-PA 340..657 38..348 345 29.4 Plus
Dper\GL19466-PA 1482 GL19466-PA 957..1147 167..354 273 32.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13988-PA 376 GA13988-PA 1..372 1..373 1686 84.2 Plus
Dpse\GA30007-PB 377 GA17030-PA 27..369 15..359 630 39.8 Plus
Dpse\GA30007-PE 427 GA30007-PE 121..424 58..364 599 41.9 Plus
Dpse\GA30007-PF 321 GA30007-PF 16..318 58..364 596 41.7 Plus
Dpse\GA30007-PD 297 GA30007-PD 5..294 72..364 595 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20562-PA 411 GM20562-PA 1..368 1..368 1949 100 Plus
Dsec\GM22325-PA 321 GM22325-PA 16..318 58..364 599 42.1 Plus
Dsec\GM18132-PA 813 GM18132-PA 493..748 105..354 360 32.9 Plus
Dsec\GM16646-PA 768 GM16646-PA 185..420 124..355 330 29.7 Plus
Dsec\GM17960-PA 1013 GM17960-PA 438..667 120..348 324 32.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10033-PA 411 GD10033-PA 1..368 1..368 1949 100 Plus
Dsim\GD14914-PA 321 GD14914-PA 16..318 58..364 599 42.1 Plus
Dsim\GD22740-PA 1079 GD22740-PA 489..744 105..354 357 32.9 Plus
Dsim\GD22942-PA 768 GD22942-PA 185..420 124..355 330 29.7 Plus
Dsim\GD23660-PA 963 GD23660-PA 388..617 120..348 322 32.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21160-PA 377 GJ21160-PA 1..373 1..373 1678 82.8 Plus
Dvir\GJ12814-PA 376 GJ12814-PA 26..368 15..359 623 39.5 Plus
Dvir\GJ19652-PA 769 GJ19652-PA 137..421 75..355 360 27.8 Plus
Dvir\GJ17940-PA 1013 GJ17940-PA 439..668 120..348 333 32.2 Plus
Dvir\GJ17588-PA 1186 GJ17588-PA 927..1121 163..354 278 33.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21366-PA 396 GK21366-PA 1..353 1..368 1718 87.5 Plus
Dwil\GK25343-PA 376 GK25343-PA 26..368 15..359 626 39.5 Plus
Dwil\GK15473-PA 1097 GK15473-PA 507..762 105..354 361 33.6 Plus
Dwil\GK24624-PA 779 GK24624-PA 147..430 78..355 337 26.8 Plus
Dwil\GK18409-PA 1034 GK18409-PA 441..687 105..348 332 32.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21875-PA 430 GE21875-PA 21..387 1..367 1950 100 Plus
Dyak\GE19713-PA 321 GE19713-PA 16..318 58..364 599 42.1 Plus
Dyak\GE14825-PA 1089 GE14825-PA 499..754 105..354 359 32.9 Plus
Dyak\GE15942-PA 768 GE15942-PA 185..420 124..355 329 29.7 Plus
Dyak\GE18902-PA 1027 GE18902-PA 452..681 120..348 321 32.2 Plus

IP17782.hyp Sequence

Translation from 156 to 1277

> IP17782.hyp
MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERP
SVSHTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDG
ATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDF
IIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAA
TVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYE
RMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEI
SQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDTEAFERIMGFLTD
VLKRNIVIYEQMFTDMARRNTNL*

IP17782.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Pka-R2-PD 373 CG15862-PD 1..373 1..373 1885 100 Plus
Pka-R2-PB 377 CG15862-PB 1..373 1..373 1769 93.8 Plus
Pka-R2-PA 377 CG15862-PA 1..373 1..373 1769 93.8 Plus
Pka-R2-PE 376 CG15862-PE 1..373 1..373 1744 93.3 Plus
Pka-R1-PAC 377 CG42341-PAC 26..369 15..359 614 40.3 Plus