IP17789.complete Sequence
556 bp assembled on 2007-01-15
GenBank Submission: BT030174
> IP17789.complete
GACTTTCAGAAAATATGCATTTAAGAAAATTTTTGTATTGTTGGCCATTG
AAATATGGCGTTATTACTGTGGGCATTGCTTTTGGACTCACGGACTTCAT
CGTGGGCAGCATTGCATGGGACATGGTTATCAGAAACAAATATCCAGACT
ATGTGGTCGAGTTCTTCAGAACCATGGACACCCGAATCTGTGTGTCCGGA
TTTGCCACCGTTTTCTGGTTGATGATGACCAACCACTTTCTTTTGATCTA
TGCCGTCTTTTACCACAAACTTTTGATAATCGGAACTTGGCTGTTGATAA
ACTACATGGTATTTTTGTTCACCCTTGTCACCGTGTTGTTGGATAGCTTG
CTAATCCTTAGAATAATTGCCCTCGGATACTGTTTGATCGTGGTGAAGTC
CTATTATAGTGAGTTGGCTGAGTCTCAGGAGGAATCATCCGATTCCAGTG
AGGAATCAACTAGTAGTGATAGCGATTAAAATGCCTCAAATGTAAGCATT
TTTTTAATTCAAAAGGCAATAAATTCGATTTATAAAGTAAAAAAAAAAAA
AAAAAA
IP17789.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:04:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42493-RA | 590 | CG42493-RA | 53..590 | 1..538 | 2690 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:56:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 7665874..7666136 | 1..263 | 1315 | 100 | Plus |
chr2R | 21145070 | chr2R | 7666360..7666531 | 367..538 | 860 | 100 | Plus |
chr2R | 21145070 | chr2R | 7666201..7666303 | 264..366 | 515 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:56:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11778578..11778840 | 1..263 | 1315 | 100 | Plus |
2R | 25286936 | 2R | 11779064..11779236 | 367..539 | 865 | 100 | Plus |
2R | 25286936 | 2R | 11778905..11779007 | 264..366 | 515 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 11779777..11780039 | 1..263 | 1315 | 100 | Plus |
2R | 25260384 | 2R | 11780263..11780435 | 367..539 | 865 | 100 | Plus |
2R | 25260384 | 2R | 11780104..11780206 | 264..366 | 515 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 15:56:53 has no hits.
IP17789.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:57:41 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 7666201..7666303 | 264..366 | 100 | -> | Plus |
chr2R | 7666360..7666531 | 367..538 | 100 | | Plus |
chr2R | 7665874..7666136 | 1..263 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:15 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42493-RA | 1..465 | 15..479 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:46:56 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42493-RA | 1..465 | 15..479 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:03:45 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:44 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42493-RA | 1..465 | 15..479 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:15 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42493-RA | 1..538 | 1..538 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:56 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42493-RA | 53..590 | 1..538 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:03:45 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:44 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42493-RA | 53..590 | 1..538 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:41 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11778578..11778840 | 1..263 | 100 | -> | Plus |
2R | 11778905..11779007 | 264..366 | 100 | -> | Plus |
2R | 11779064..11779235 | 367..538 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:41 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11778578..11778840 | 1..263 | 100 | -> | Plus |
2R | 11778905..11779007 | 264..366 | 100 | -> | Plus |
2R | 11779064..11779235 | 367..538 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:41 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11778578..11778840 | 1..263 | 100 | -> | Plus |
2R | 11778905..11779007 | 264..366 | 100 | -> | Plus |
2R | 11779064..11779235 | 367..538 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:56 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7666569..7666740 | 367..538 | 100 | | Plus |
arm_2R | 7666083..7666345 | 1..263 | 100 | -> | Plus |
arm_2R | 7666410..7666512 | 264..366 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:37 Download gff for
IP17789.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11779777..11780039 | 1..263 | 100 | -> | Plus |
2R | 11780104..11780206 | 264..366 | 100 | -> | Plus |
2R | 11780263..11780434 | 367..538 | 100 | | Plus |
IP17789.hyp Sequence
Translation from 2 to 478
> IP17789.hyp
LSENMHLRKFLYCWPLKYGVITVGIAFGLTDFIVGSIAWDMVIRNKYPDY
VVEFFRTMDTRICVSGFATVFWLMMTNHFLLIYAVFYHKLLIIGTWLLIN
YMVFLFTLVTVLLDSLLILRIIALGYCLIVVKSYYSELAESQEESSDSSE
ESTSSDSD*
IP17789.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42493-PA | 154 | CG42493-PA | 1..154 | 5..158 | 799 | 100 | Plus |
IP17789.pep Sequence
Translation from 2 to 478
> IP17789.pep
LSENMHLRKFLYCWPLKYGVITVGIAFGLTDFIVGSIAWDMVIRNKYPDY
VVEFFRTMDTRICVSGFATVFWLMMTNHFLLIYAVFYHKLLIIGTWLLIN
YMVFLFTLVTVLLDSLLILRIIALGYCLIVVKSYYSELAESQEESSDSSE
ESTSSDSD*
IP17789.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:18:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20218-PA | 157 | GG20218-PA | 1..154 | 5..158 | 682 | 83.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42493-PA | 154 | CG42493-PA | 1..154 | 5..158 | 799 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:18:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10083-PA | 105 | GL10083-PA | 1..105 | 5..143 | 208 | 37.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:18:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25067-PA | 139 | GA25067-PA | 1..139 | 5..143 | 345 | 48.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:18:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10813-PA | 180 | GD10813-PA | 44..178 | 23..157 | 646 | 92.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:18:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12378-PA | 157 | GE12378-PA | 1..154 | 5..158 | 667 | 82.5 | Plus |