Clone IP17789 Report

Search the DGRC for IP17789

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:177
Well:89
Vector:pOT2
Associated Gene/TranscriptCG42493-RA
Protein status:IP17789.pep: gold
Sequenced Size:556

Clone Sequence Records

IP17789.complete Sequence

556 bp assembled on 2007-01-15

GenBank Submission: BT030174

> IP17789.complete
GACTTTCAGAAAATATGCATTTAAGAAAATTTTTGTATTGTTGGCCATTG
AAATATGGCGTTATTACTGTGGGCATTGCTTTTGGACTCACGGACTTCAT
CGTGGGCAGCATTGCATGGGACATGGTTATCAGAAACAAATATCCAGACT
ATGTGGTCGAGTTCTTCAGAACCATGGACACCCGAATCTGTGTGTCCGGA
TTTGCCACCGTTTTCTGGTTGATGATGACCAACCACTTTCTTTTGATCTA
TGCCGTCTTTTACCACAAACTTTTGATAATCGGAACTTGGCTGTTGATAA
ACTACATGGTATTTTTGTTCACCCTTGTCACCGTGTTGTTGGATAGCTTG
CTAATCCTTAGAATAATTGCCCTCGGATACTGTTTGATCGTGGTGAAGTC
CTATTATAGTGAGTTGGCTGAGTCTCAGGAGGAATCATCCGATTCCAGTG
AGGAATCAACTAGTAGTGATAGCGATTAAAATGCCTCAAATGTAAGCATT
TTTTTAATTCAAAAGGCAATAAATTCGATTTATAAAGTAAAAAAAAAAAA
AAAAAA

IP17789.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42493-RA 590 CG42493-RA 53..590 1..538 2690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7665874..7666136 1..263 1315 100 Plus
chr2R 21145070 chr2R 7666360..7666531 367..538 860 100 Plus
chr2R 21145070 chr2R 7666201..7666303 264..366 515 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11778578..11778840 1..263 1315 100 Plus
2R 25286936 2R 11779064..11779236 367..539 865 100 Plus
2R 25286936 2R 11778905..11779007 264..366 515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11779777..11780039 1..263 1315 100 Plus
2R 25260384 2R 11780263..11780435 367..539 865 100 Plus
2R 25260384 2R 11780104..11780206 264..366 515 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:56:53 has no hits.

IP17789.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:57:41 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7666201..7666303 264..366 100 -> Plus
chr2R 7666360..7666531 367..538 100   Plus
chr2R 7665874..7666136 1..263 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:15 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 1..465 15..479 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:46:56 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 1..465 15..479 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:03:45 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:44 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 1..465 15..479 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:15 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 1..538 1..538 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:56 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 53..590 1..538 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:03:45 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:44 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
CG42493-RA 53..590 1..538 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:41 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11778578..11778840 1..263 100 -> Plus
2R 11778905..11779007 264..366 100 -> Plus
2R 11779064..11779235 367..538 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:41 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11778578..11778840 1..263 100 -> Plus
2R 11778905..11779007 264..366 100 -> Plus
2R 11779064..11779235 367..538 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:41 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11778578..11778840 1..263 100 -> Plus
2R 11778905..11779007 264..366 100 -> Plus
2R 11779064..11779235 367..538 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:56 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7666569..7666740 367..538 100   Plus
arm_2R 7666083..7666345 1..263 100 -> Plus
arm_2R 7666410..7666512 264..366 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:37 Download gff for IP17789.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11779777..11780039 1..263 100 -> Plus
2R 11780104..11780206 264..366 100 -> Plus
2R 11780263..11780434 367..538 100   Plus

IP17789.hyp Sequence

Translation from 2 to 478

> IP17789.hyp
LSENMHLRKFLYCWPLKYGVITVGIAFGLTDFIVGSIAWDMVIRNKYPDY
VVEFFRTMDTRICVSGFATVFWLMMTNHFLLIYAVFYHKLLIIGTWLLIN
YMVFLFTLVTVLLDSLLILRIIALGYCLIVVKSYYSELAESQEESSDSSE
ESTSSDSD*

IP17789.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG42493-PA 154 CG42493-PA 1..154 5..158 799 100 Plus

IP17789.pep Sequence

Translation from 2 to 478

> IP17789.pep
LSENMHLRKFLYCWPLKYGVITVGIAFGLTDFIVGSIAWDMVIRNKYPDY
VVEFFRTMDTRICVSGFATVFWLMMTNHFLLIYAVFYHKLLIIGTWLLIN
YMVFLFTLVTVLLDSLLILRIIALGYCLIVVKSYYSELAESQEESSDSSE
ESTSSDSD*

IP17789.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20218-PA 157 GG20218-PA 1..154 5..158 682 83.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42493-PA 154 CG42493-PA 1..154 5..158 799 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10083-PA 105 GL10083-PA 1..105 5..143 208 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25067-PA 139 GA25067-PA 1..139 5..143 345 48.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10813-PA 180 GD10813-PA 44..178 23..157 646 92.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12378-PA 157 GE12378-PA 1..154 5..158 667 82.5 Plus