Clone IP17794 Report

Search the DGRC for IP17794

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:177
Well:94
Vector:pOT2
Associated Gene/TranscriptCG34234-RA
Protein status:IP17794.pep: gold
Sequenced Size:644

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34234 2008-04-29 Release 5.5 accounting
CG34234 2008-08-15 Release 5.9 accounting
CG34234 2008-12-18 5.12 accounting

Clone Sequence Records

IP17794.complete Sequence

644 bp assembled on 2007-01-16

GenBank Submission: BT030175

> IP17794.complete
CATATTTCATGAGACGATGCAAGACAATTCAAATGCTGTTCCTCTGTTTG
ATGATGAGAATGCGAGAAAGTCATGAGCGGCCCACGCCGAAAAATCTGCT
GGAACAAATGCTGCCTGCTGACACCTTTGACGTTATCCGGAGAATACCTC
GCTCCGATGAACCCGGTCCGGATGCCAAAGGGGACCTGAAGCTGTTGCAT
GCTCCCTGCGAGTTTGACTTGATAAGATACACATCGATTAACCACTATCC
CATTTATTGCCTGCCCGTCTACACAAATCGGCACGTGAACGAGGACTGGT
ATCGACTTTATAGGACCTACGACACCGAGGGATTTGTTTTCGGGCAGTTT
TACGAGCGTCTCCAGCGGTACGAGTTGGACTGAATTAATGCCCTTTTTCA
GAAAGAATAAGATTTAGACAAAATCTGTGATATCGATACTGTGGTAGCGT
TGCAGAGATCCCAATCGCGTGTGTGGCGAAGGACGCAGACAGATAACACA
TTCCTCCGTGCTGAAAATCAATTATAATTAGTCGTGGGAAACAACTAAAA
GAATATAAAAATGGCCCGTTGGTTTATAAAAAATATAATACTTTAATCTG
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP17794.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234.a 619 CG34234.a 17..617 1..601 3005 100 Plus
CG12370-RB 3076 CG12370-RB 1896..2356 513..53 2305 100 Minus
CG34234-RA 351 CG34234-RA 1..351 33..383 1755 100 Plus
CG12370-RB 3076 CG12370-RB 2413..2465 53..1 265 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8374020..8374567 600..53 2725 99.8 Minus
chr2R 21145070 chr2R 8374624..8374676 53..1 265 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12486718..12487266 601..53 2745 100 Minus
2R 25286936 2R 12487323..12487375 53..1 265 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12487917..12488465 601..53 2745 100 Minus
2R 25260384 2R 12488522..12488574 53..1 265 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:12:41 has no hits.

IP17794.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:13:23 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8374020..8374566 54..600 99 <- Minus
chr2R 8374624..8374676 1..53 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:10:02 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 1..351 33..383 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:10:24 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 1..351 33..383 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:56:00 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 1..351 33..383 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:20:33 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 1..351 33..383 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:34 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 1..351 33..383 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:39:26 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG12370-RB 2386..2438 1..53 100   Minus
CG12370-RB 1863..2328 54..519 99 <- Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:10:24 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 4..603 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:56:00 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 4..603 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:20:33 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG12370-RB 1863..2328 54..519 99 <- Minus
CG12370-RB 2386..2438 1..53 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:34 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 4..603 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:23 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12486719..12487265 54..600 100 <- Minus
2R 12487323..12487375 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:23 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12486719..12487265 54..600 100 <- Minus
2R 12487323..12487375 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:23 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12486719..12487265 54..600 100 <- Minus
2R 12487323..12487375 1..53 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:56:00 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8374224..8374770 54..600 100 <- Minus
arm_2R 8374828..8374880 1..53 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:42:32 Download gff for IP17794.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12487918..12488464 54..600 100 <- Minus
2R 12488522..12488574 1..53 100   Minus

IP17794.pep Sequence

Translation from 2 to 382

> IP17794.pep
YFMRRCKTIQMLFLCLMMRMRESHERPTPKNLLEQMLPADTFDVIRRIPR
SDEPGPDAKGDLKLLHAPCEFDLIRYTSINHYPIYCLPVYTNRHVNEDWY
RLYRTYDTEGFVFGQFYERLQRYELD*

IP17794.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12449-PA 715 GF12449-PA 618..715 28..126 368 69.7 Plus
Dana\GF13536-PA 141 GF13536-PA 30..132 25..126 178 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22575-PA 116 GG22575-PA 1..116 11..126 544 87.1 Plus
Dere\GG22791-PA 138 GG22791-PA 49..130 46..126 168 41.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24409-PA 186 GH24409-PA 110..176 61..126 175 47.8 Plus
Dgri\GH16786-PA 167 GH16786-PA 91..157 61..126 174 47.8 Plus
Dgri\GH16785-PA 204 GH16785-PA 127..193 61..126 161 40.3 Plus
Dgri\GH24398-PA 152 GH24398-PA 75..141 61..126 159 40.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-PB 124 CG34234-PB 1..124 3..126 683 100 Plus
CG30270-PF 130 CG30270-PF 51..122 56..126 178 44.4 Plus
CG30270-PE 146 CG30270-PE 67..138 56..126 178 44.4 Plus
CG30270-PD 78 CG30270-PD 4..70 61..126 174 46.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13446-PA 169 GI13446-PA 73..158 44..126 163 38.4 Plus
Dmoj\GI20325-PA 142 GI20325-PA 51..134 43..126 135 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11376-PA 180 GL11376-PA 104..170 61..126 159 40.3 Plus
Dper\GL12051-PA 150 GL12051-PA 14..143 2..126 157 28 Plus
Dper\GL11377-PA 200 GL11377-PA 126..190 61..126 153 42.4 Plus
Dper\GL10683-PA 158 GL10683-PA 65..147 45..126 149 38.6 Plus
Dper\GL11378-PA 120 GL11378-PA 47..108 66..126 143 40.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24701-PA 180 GA24701-PA 104..170 61..126 163 41.8 Plus
Dpse\GA26175-PA 150 GA26175-PA 14..143 2..126 156 28 Plus
Dpse\GA24702-PA 161 GA24702-PA 87..151 61..126 155 42.4 Plus
Dpse\GA24446-PA 158 GA24446-PA 65..147 45..126 149 38.6 Plus
Dpse\GA24703-PA 120 GA24703-PA 47..108 66..126 144 40.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20357-PA 116 GM20357-PA 1..116 11..126 570 91.4 Plus
Dsec\GM15950-PA 146 GM15950-PA 59..138 48..126 175 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25836-PA 116 GD25836-PA 1..116 11..126 576 92.2 Plus
Dsim\GD18394-PA 81 GD18394-PA 2..73 56..126 169 44.4 Plus
Dsim\GD11703-PA 78 GD11703-PA 4..70 61..126 165 46.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11807-PA 181 GJ11807-PA 88..170 43..126 173 40 Plus
Dvir\GJ11808-PA 187 GJ11808-PA 94..176 43..126 173 38.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19394-PA 110 GK19394-PA 15..98 44..126 184 40.5 Plus
Dwil\GK19406-PA 111 GK19406-PA 19..99 45..125 151 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13444-PA 116 GE13444-PA 1..116 11..126 539 86.2 Plus
Dyak\GE14022-PA 138 GE14022-PA 49..130 46..126 163 42.7 Plus

IP17794.hyp Sequence

Translation from 2 to 382

> IP17794.hyp
YFMRRCKTIQMLFLCLMMRMRESHERPTPKNLLEQMLPADTFDVIRRIPR
SDEPGPDAKGDLKLLHAPCEFDLIRYTSINHYPIYCLPVYTNRHVNEDWY
RLYRTYDTEGFVFGQFYERLQRYELD*

IP17794.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-PA 116 CG34234-PA 1..116 11..126 640 100 Plus
CG30270-PD 78 CG30270-PD 4..70 61..126 174 46.3 Plus
CG30270-PC 78 CG30270-PC 4..70 61..126 174 46.3 Plus