Clone IP17804 Report

Search the DGRC for IP17804

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:178
Well:4
Vector:pOT2
Associated Gene/TranscriptCG34161-RB
Protein status:IP17804.pep: gold
Sequenced Size:530

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34161 2008-04-29 Release 5.5 accounting
CG34161 2008-08-15 Release 5.9 accounting
CG34161 2008-12-18 5.12 accounting

Clone Sequence Records

IP17804.complete Sequence

530 bp assembled on 2007-01-15

GenBank Submission: BT030176

> IP17804.complete
AAAGTATAAGAAATTTCTTTAAAAATGAGCAGTCAAATTAAAAAGTCCAA
AACGACCACCAAGAAATTGGTGAAATCATCTCCGAAAGCTCAACTTCCAA
AAGCTGCGGCACAGAATCAAATTTTTAGTTGCCAATTCGAGGTGTTTGGT
CATGTGCAAGGTGTCTTCTTTCGCAAGGCCATTGAGCTGGGCATAACTGG
CTGGTGCATGAACACAACTCAAGGAACGGTTCAGGGAATGCTCGAAGGAT
CCTTGGACCAAATGACTGATATGAAATACTGGCTGCAGCACAAGGGAAGT
CCTCGTTCGGTGATCGAAAAGGCTGTATTCTCCGAGAATGAACCACTGCC
CATCAACAACTTTAAGATGTTCTCGATTCGTCGCTAGGGATTATTTTACG
CCAAAATTCATTTATTAATTTTATAAAGTTGAAATTAAGATGTGACTCGA
GCTGAAACGTGAGAATCGCTTTGAGCACGCAATATATACATATGTATGTG
CTTCTAGATCCCAAAAAAAAAAAAAAAAAA

IP17804.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34161-RB 512 CG34161-RB 1..512 1..512 2560 100 Plus
CG34161-RA 672 CG34161-RA 266..606 175..515 1705 100 Plus
CG34161-RC 672 CG34161-RC 266..606 175..515 1705 100 Plus
CG34161-RA 672 CG34161-RA 77..253 1..177 885 100 Plus
CG34161-RC 672 CG34161-RC 77..253 1..177 885 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10579774..10580013 512..273 1200 100 Minus
chr2L 23010047 chr2L 10580308..10580469 162..1 810 100 Minus
chr2L 23010047 chr2L 10580068..10580166 273..175 495 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10580963..10581205 515..273 1215 100 Minus
2L 23513712 2L 10581500..10581661 162..1 810 100 Minus
2L 23513712 2L 10581260..10581358 273..175 495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10580963..10581205 515..273 1215 100 Minus
2L 23513712 2L 10581500..10581661 162..1 810 100 Minus
2L 23513712 2L 10581260..10581358 273..175 495 100 Minus
Blast to na_te.dros performed 2019-03-15 12:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy2 6841 gypsy2 GYPSY2 6841bp 5487..5558 9..80 108 61.1 Plus

IP17804.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:52:54 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10579774..10580013 273..512 100 <- Minus
chr2L 10580069..10580163 178..272 100 <- Minus
chr2L 10580232..10580248 161..177 100 <- Minus
chr2L 10580310..10580469 1..160 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:10:05 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..152 25..177 99 -> Plus
CG34161-RA 169..378 178..387 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:52 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RB 1..363 25..387 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:51:36 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RB 1..363 25..387 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:10 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..152 25..177 99 -> Plus
CG34161-RA 169..378 178..387 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:12:59 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RB 1..363 25..387 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:11 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..176 1..177 99 -> Plus
CG34161-RA 193..520 178..505 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:52 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RB 2..513 1..512 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:51:36 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RB 42..553 1..512 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:11 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..176 1..177 99 -> Plus
CG34161-RA 193..520 178..505 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:12:59 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RB 42..553 1..512 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:52:54 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10580966..10581205 273..512 100 <- Minus
2L 10581261..10581355 178..272 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus
2L 10581502..10581661 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:52:54 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10580966..10581205 273..512 100 <- Minus
2L 10581261..10581355 178..272 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus
2L 10581502..10581661 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:52:54 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10580966..10581205 273..512 100 <- Minus
2L 10581261..10581355 178..272 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus
2L 10581502..10581661 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:51:36 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10580966..10581205 273..512 100 <- Minus
arm_2L 10581261..10581355 178..272 100 <- Minus
arm_2L 10581424..10581440 161..177 100 <- Minus
arm_2L 10581502..10581661 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:20 Download gff for IP17804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10581502..10581661 1..160 100   Minus
2L 10580966..10581205 273..512 100 <- Minus
2L 10581261..10581355 178..272 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus

IP17804.hyp Sequence

Translation from 24 to 386

> IP17804.hyp
MSSQIKKSKTTTKKLVKSSPKAQLPKAAAQNQIFSCQFEVFGHVQGVFFR
KAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQHKGSPRSVIEKA
VFSENEPLPINNFKMFSIRR*

IP17804.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34161-PB 120 CG34161-PB 1..120 1..120 623 100 Plus
CG34161-PC 125 CG34161-PC 1..125 1..120 607 96 Plus
CG34161-PA 125 CG34161-PA 1..125 1..120 607 96 Plus
CG18371-PA 110 CG18371-PA 7..99 32..119 231 50.5 Plus
CG11052-PD 149 CG11052-PD 29..146 6..118 221 39 Plus

IP17804.pep Sequence

Translation from 24 to 386

> IP17804.pep
MSSQIKKSKTTTKKLVKSSPKAQLPKAAAQNQIFSCQFEVFGHVQGVFFR
KAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQHKGSPRSVIEKA
VFSENEPLPINNFKMFSIRR*

IP17804.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14085-PA 119 GF14085-PA 1..119 1..120 448 70.4 Plus
Dana\GF18541-PA 102 GF18541-PA 4..102 27..120 294 55.6 Plus
Dana\GF12022-PA 108 GF12022-PA 7..99 32..119 232 48.4 Plus
Dana\GF19668-PA 116 GF19668-PA 2..97 29..119 232 49 Plus
Dana\GF16871-PA 150 GF16871-PA 57..148 33..116 224 47.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10375-PA 124 GG10375-PA 1..124 1..120 514 88 Plus
Dere\GG16952-PA 102 GG16952-PA 9..102 32..120 255 53.2 Plus
Dere\GG20418-PA 107 GG20418-PA 5..98 31..119 238 50 Plus
Dere\GG24762-PA 149 GG24762-PA 25..146 2..118 229 40.2 Plus
Dere\GG23897-PA 119 GG23897-PA 2..97 28..119 207 48.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11746-PA 124 GH11746-PA 31..124 32..120 311 56.4 Plus
Dgri\GH11331-PA 99 GH11331-PA 6..99 32..120 307 56.4 Plus
Dgri\GH18239-PA 96 GH18239-PA 4..96 33..120 264 54.8 Plus
Dgri\GH22670-PA 111 GH22670-PA 6..102 28..119 234 45.4 Plus
Dgri\GH15191-PA 141 GH15191-PA 13..135 3..118 207 39.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34161-PB 120 CG34161-PB 1..120 1..120 623 100 Plus
CG34161-PC 125 CG34161-PC 1..125 1..120 607 96 Plus
CG34161-PA 125 CG34161-PA 1..125 1..120 607 96 Plus
CG18371-PA 110 CG18371-PA 7..99 32..119 231 50.5 Plus
CG11052-PD 149 CG11052-PD 29..146 6..118 221 39 Plus
CG11052-PC 149 CG11052-PC 29..146 6..118 221 39 Plus
CG11052-PB 149 CG11052-PB 29..146 6..118 221 39 Plus
CG11052-PA 149 CG11052-PA 29..146 6..118 221 39 Plus
Acyp2-PB 102 CG18505-PB 9..101 32..119 216 45.2 Plus
Acyp2-PA 102 CG18505-PA 9..101 32..119 216 45.2 Plus
Acyp-PB 120 CG16870-PB 2..97 29..119 208 46.9 Plus
Acyp-PA 120 CG16870-PA 2..97 29..119 208 46.9 Plus
CG14022-PB 101 CG14022-PB 9..100 33..119 146 34.8 Plus
CG14022-PA 101 CG14022-PA 9..100 33..119 146 34.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17837-PA 99 GI17837-PA 3..99 29..120 310 55.7 Plus
Dmoj\GI10195-PA 96 GI10195-PA 3..96 32..120 259 54.3 Plus
Dmoj\GI21180-PA 110 GI21180-PA 4..99 29..119 234 46.9 Plus
Dmoj\GI22288-PA 120 GI22288-PA 4..95 33..119 234 51.1 Plus
Dmoj\GI10542-PA 101 GI10542-PA 8..100 32..119 157 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26404-PA 132 GL26404-PA 1..116 1..119 330 54.8 Plus
Dper\GL22235-PA 102 GL22235-PA 1..102 24..120 282 52 Plus
Dper\GL16721-PA 110 GL16721-PA 4..99 29..119 237 46.9 Plus
Dper\GL22340-PA 143 GL22340-PA 28..141 11..119 232 42.1 Plus
Dper\GL21249-PA 116 GL21249-PA 4..97 31..119 226 45.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28850-PA 117 GA28850-PA 1..117 1..120 335 55.2 Plus
Dpse\GA27428-PA 102 GA27428-PA 1..102 24..120 282 52 Plus
Dpse\GA14909-PA 110 GA14909-PA 4..99 29..119 234 46.9 Plus
Dpse\GA28779-PA 116 GA28779-PA 4..97 31..119 226 45.7 Plus
Dpse\GA27462-PB 128 GA27462-PB 28..126 11..119 193 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11586-PA 124 GM11586-PA 1..124 1..120 516 87.2 Plus
Dsec\GM21504-PA 110 GM21504-PA 7..99 32..119 237 50.5 Plus
Dsec\GM10438-PA 149 GM10438-PA 56..146 33..118 223 47.3 Plus
Dsec\GM24259-PA 102 GM24259-PA 4..102 27..120 222 46.5 Plus
Dsec\GM15374-PA 120 GM15374-PA 2..97 29..119 213 46.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22242-PA 124 GD22242-PA 1..124 1..120 513 87.2 Plus
Dsim\GD10999-PA 110 GD10999-PA 7..99 32..119 237 50.5 Plus
Dsim\GD19440-PA 149 GD19440-PA 52..146 29..118 220 45.3 Plus
Dsim\Acyp-PA 120 GD23938-PA 2..97 29..119 213 46.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17330-PA 99 GJ17330-PA 2..99 28..120 324 57.1 Plus
Dvir\GJ24080-PA 122 GJ24080-PA 4..95 33..119 241 51.1 Plus
Dvir\GJ21038-PA 111 GJ21038-PA 5..99 30..119 238 47.4 Plus
Dvir\GJ23483-PA 96 GJ23483-PA 4..95 33..119 236 53.3 Plus
Dvir\GJ21758-PA 101 GJ21758-PA 8..100 32..119 156 36.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15522-PA 126 GK15522-PA 18..126 15..120 365 63.1 Plus
Dwil\GK12388-PA 99 GK12388-PA 2..98 28..119 250 53.6 Plus
Dwil\GK19418-PA 107 GK19418-PA 6..99 31..119 238 48.9 Plus
Dwil\GK14028-PA 139 GK14028-PA 46..137 33..119 214 45.7 Plus
Dwil\GK18433-PA 101 GK18433-PA 8..100 32..119 160 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13517-PA 124 GE13517-PA 1..124 1..120 532 91.2 Plus
Dyak\GE24338-PA 102 GE24338-PA 9..102 32..120 259 53.2 Plus
Dyak\GE12579-PA 110 GE12579-PA 6..99 31..119 237 48.9 Plus
Dyak\GE25751-PA 149 GE25751-PA 29..146 6..118 214 37.3 Plus
Dyak\GE19011-PA 120 GE19011-PA 2..97 28..119 205 47.4 Plus