BDGP Sequence Production Resources |
Search the DGRC for IP17824
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 178 |
Well: | 24 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34136-RA |
Protein status: | IP17824.pep: gold |
Sequenced Size: | 1065 |
Gene | Date | Evidence |
---|---|---|
CG34136 | 2008-04-29 | Release 5.5 accounting |
CG34136 | 2008-08-15 | Release 5.9 accounting |
Tsp29Fa | 2008-08-15 | Release 5.9 accounting |
Tsp29Fa | 2008-12-18 | 5.12 accounting |
CG34136 | 2008-12-18 | 5.12 accounting |
1065 bp assembled on 2007-01-15
GenBank Submission: BT030177
> IP17824.complete TCCAGCGTGGCAGACCGGCACAAAGTTGGATGCCTCGACGGATTCTCCGG ATACATTTCCGCCCATGCGGTCAGCCTAGGAGCTGCAGGGGTGGTCATTG CCATCCTCCAGTTCTTTGGCGTAATCTTTGCCTGCTACATTGCACGTGAG ATTAAAATCCGTAATGGAATTACTGGTTTTATGTAGGTCCGGAGGAAATC GATTCTGTAGGATGAGATGAGCTAGATAAGAATGGTGCCGATATTTACTT TAAATTCAATGATGTTCTTGGACATATACTGACATTTACCCTTGCTTGTA AAAATAAATAAATATATTTCTAAACAAAAAAAAAAAAAAAAAAGTTGTGC TCCGCAGCAACAACCGTTAGCCGGAAAGAAGAGAGCCGGAAGCGCGTGCC GCTAAAGTTTACGGAAATAAAGGCGGACAAAGGTTCATCCTCGCCTGAAA CTGACAAAGTGCCAGAATCCAGATTAAACGATTTACGAGCGACTAAAAAA AAAGGAAAAACATTTCGGGCGGTGCAGTGTGCATTGCAAAGGCATTGCAG AACTCTAAGAACACATCTCCTCCGCACCCGCATCCGGAAACGGATTGGGA ATATCGGAAAATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTACTGTGCC TTGCATTCTTCGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTGAATGAG CACCAACAATTGATGCCGAAAGTGCCTCAATGGCACTGCCTGCGCTACTT TAAGCATGATGTCCTGATGATGCGCCGCTGTCGCCACTTGCGAGTCCCTA CAGCGCCACGACTGGGCGATGTCCTCAAGCGAAAGAAGAAATAGTATAAG GCCCACAGACAATCGTCCACAATACTCAAAACGACTGAACCAGAAGATCA ATTAAAAGAACATTTTTTAAAGGATTTCTAACCAGACCAAAGCTAAATCA AATATATACTACCAAATATACAATTTCTGGAACTTAGTATAAGTCTAACC AATTGTACTTCATAGTTGAGTAAGATTTCAATAAAACGACTAAATATATA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 21095412..21095768 | 344..700 | 1785 | 100 | Plus |
chr2L | 23010047 | chr2L | 21097072..21097422 | 699..1049 | 1755 | 100 | Plus |
chr2L | 23010047 | chr2L | 8934795..8935019 | 107..331 | 1125 | 100 | Plus |
chr2L | 23010047 | chr2L | 8934561..8934671 | 1..111 | 555 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 21096922..21097278 | 344..700 | 1785 | 100 | Plus |
2L | 23513712 | 2L | 21098582..21098936 | 699..1053 | 1775 | 100 | Plus |
2L | 23513712 | 2L | 8935878..8936102 | 107..331 | 1125 | 100 | Plus |
2L | 23513712 | 2L | 8935644..8935754 | 1..111 | 555 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 21096922..21097278 | 344..700 | 1785 | 100 | Plus |
2L | 23513712 | 2L | 21098582..21098936 | 699..1053 | 1775 | 100 | Plus |
2L | 23513712 | 2L | 8935878..8936102 | 107..331 | 1125 | 100 | Plus |
2L | 23513712 | 2L | 8935644..8935754 | 1..111 | 555 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Idefix | 7411 | Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). | 6262..6344 | 897..975 | 117 | 63.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 21095411..21095768 | 344..700 | 99 | -> | Plus |
chr2L | 21097074..21097422 | 701..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..234 | 611..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..234 | 611..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..234 | 611..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..234 | 611..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..234 | 611..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..706 | 344..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..706 | 344..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..706 | 344..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..627 | 389..1015 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34136-RA | 1..706 | 344..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21096921..21097278 | 343..700 | 99 | -> | Plus |
2L | 21098584..21098932 | 701..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21096921..21097278 | 343..700 | 99 | -> | Plus |
2L | 21098584..21098932 | 701..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21096921..21097278 | 343..700 | 99 | -> | Plus |
2L | 21098584..21098932 | 701..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 21096921..21097278 | 343..700 | 99 | -> | Plus |
arm_2L | 21098584..21098932 | 701..1049 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 21096921..21097278 | 343..700 | 99 | -> | Plus |
2L | 21098584..21098932 | 701..1049 | 100 | Plus |
Translation from 610 to 843
> IP17824.pep MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21277-PA | 77 | GG21277-PA | 1..77 | 1..77 | 399 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10408-PA | 79 | GH10408-PA | 1..78 | 1..77 | 368 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34136-PA | 77 | CG34136-PA | 1..77 | 1..77 | 427 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23282-PA | 78 | GI23282-PA | 1..78 | 1..77 | 364 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25886-PA | 78 | GL25886-PA | 1..78 | 1..77 | 358 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25175-PA | 78 | GA25175-PA | 1..78 | 1..77 | 358 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23390-PA | 77 | GM23390-PA | 1..77 | 1..77 | 399 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24299-PA | 77 | GD24299-PA | 1..77 | 1..77 | 399 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23791-PA | 79 | GJ23791-PA | 1..78 | 1..77 | 313 | 84.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24316-PA | 78 | GK24316-PA | 1..77 | 1..77 | 368 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12893-PA | 77 | GE12893-PA | 1..77 | 1..77 | 399 | 98.7 | Plus |
Translation from 610 to 843
> IP17824.hyp MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD VLMMRRCRHLRVPTAPRLGDVLKRKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34136-PA | 77 | CG34136-PA | 1..77 | 1..77 | 427 | 100 | Plus |