Clone IP17841 Report

Search the DGRC for IP17841

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:178
Well:41
Vector:pOT2
Protein status:IP17841.pep:
Sequenced Size:872

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34010 2008-04-29 Release 5.5 accounting
CG34010 2008-08-15 Release 5.9 accounting
CG34010 2008-12-18 5.12 accounting

Clone Sequence Records

IP17841.complete Sequence

872 bp assembled on 2007-01-16

GenBank Submission: BT030180

> IP17841.complete
CCTATACTGATAGAAAAATCTCAGTGGCCAGAGCTCAGAGATTTGTACGC
GAATGATAGAACTAATCTCACGGGATTCGACTTAATCGAGTACTTTTTAA
ATTACATACCCTTATCCACAACCGAATCCATAAAGATATATACAACTGAT
ACGGATTGGAGAACACATGGCAGTTATATACTAATTCATTATTTGGAGAA
CAAGGCCTATATTTATATGAATACCATTAAGGGAACCCCAGAAGATCTTG
GCAAATTGTTGAACTCTCTAAAACTTAAAGTGTTTCATTTAATCTGTGGC
TATGAAGAACGATTCAAACCATTAGTTGAGGCATATTGGCTGAATTTGGG
TCAAGATTTGATTAATCTTGAACACCAGGGCGCTATTGTTTACCACCTGC
CAAGCACCGAAATTCCCAGTTGGAAACCAAGTTTGAGTACCTCTTGCAAA
GTGGCTTATATCACATCAAATCATGCCGAATTGGTCGACAAACATTGGGC
TTATCGTTCAGCTGATTCTATAACTATGATAAGGGGTTTTATGGAGAACA
ATCTCGCTGTTGGTGTTTTTGATAACCAAGGAGAACCCCTAGCGTGGTGT
CTAAGATCTCCTCATGGTAGTTTGAGTAACCTACACGTTTTATCCTCACA
TCGTCGAATGGGATTGGGTTCTTTGGCAGTGCGCTTTATGGCTAATGAAA
TCAAGTTAAAGGGCTCAGAAGTTCTGGCCACAGTTGTTCCCGAAAACGAG
GGTTCGCAAAAAATGTTCGAGAAACTAGGATTCAACAATATCAACAAACT
CTACTGGGCAGTGATACCGTGCACTTTATAAATAAAGAATAAATACAGAT
TACAAAAAAAAAAAAAAAAAAA

IP17841.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34010-RA 1043 CG34010-RA 151..1006 1..856 4280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8009155..8009399 431..187 1195 99.2 Minus
chr2L 23010047 chr2L 8008623..8008872 853..604 1175 98 Minus
chr2L 23010047 chr2L 8009464..8009648 186..2 910 99.5 Minus
chr2L 23010047 chr2L 8008925..8009100 605..430 835 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8009600..8009852 856..604 1265 100 Minus
2L 23513712 2L 8010135..8010379 431..187 1225 100 Minus
2L 23513712 2L 8010444..8010629 186..1 930 100 Minus
2L 23513712 2L 8009905..8010080 605..430 880 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8009600..8009852 856..604 1265 100 Minus
2L 23513712 2L 8010135..8010379 431..187 1225 100 Minus
2L 23513712 2L 8010444..8010629 186..1 930 100 Minus
2L 23513712 2L 8009905..8010080 605..430 880 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:56:49 has no hits.

IP17841.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:57:42 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8008623..8008870 606..853 97 <- Minus
chr2L 8008925..8009098 432..605 98 <- Minus
chr2L 8009155..8009399 187..431 99 <- Minus
chr2L 8009464..8009648 1..186 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:10:14 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..837 1..831 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:37 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..837 1..831 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:02:25 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..837 1..831 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:18 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..837 1..831 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:32 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..837 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:22 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..837 1..831 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:37 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..859 1..853 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:02:25 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 24..876 1..853 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:18 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 7..837 1..831 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:32 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
CG34010-RA 24..876 1..853 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:42 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8009603..8009850 606..853 100 <- Minus
2L 8009905..8010078 432..605 100 <- Minus
2L 8010135..8010379 187..431 100 <- Minus
2L 8010444..8010629 1..186 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:42 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8009603..8009850 606..853 100 <- Minus
2L 8009905..8010078 432..605 100 <- Minus
2L 8010135..8010379 187..431 100 <- Minus
2L 8010444..8010629 1..186 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:42 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8009603..8009850 606..853 100 <- Minus
2L 8009905..8010078 432..605 100 <- Minus
2L 8010135..8010379 187..431 100 <- Minus
2L 8010444..8010629 1..186 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:02:25 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8009603..8009850 606..853 100 <- Minus
arm_2L 8009905..8010078 432..605 100 <- Minus
arm_2L 8010135..8010379 187..431 100 <- Minus
arm_2L 8010444..8010629 1..186 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:21 Download gff for IP17841.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8009603..8009850 606..853 100 <- Minus
2L 8009905..8010078 432..605 100 <- Minus
2L 8010135..8010379 187..431 100 <- Minus
2L 8010444..8010629 1..186 100   Minus

IP17841.pep Sequence

Translation from 0 to 830

> IP17841.pep
PILIEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTD
TDWRTHGSYILIHYLENKAYIYMNTIKGTPEDLGKLLNSLKLKVFHLICG
YEERFKPLVEAYWLNLGQDLINLEHQGAIVYHLPSTEIPSWKPSLSTSCK
VAYITSNHAELVDKHWAYRSADSITMIRGFMENNLAVGVFDNQGEPLAWC
LRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVVPENE
GSQKMFEKLGFNNINKLYWAVIPCTL*

IP17841.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19707-PA 212 GF19707-PA 1..212 63..273 685 60.4 Plus
Dana\GF15332-PA 277 GF15332-PA 8..276 2..270 406 33.1 Plus
Dana\GF14490-PA 293 GF14490-PA 14..279 7..272 223 28.2 Plus
Dana\GF14492-PA 284 GF14492-PA 30..268 31..269 181 25.3 Plus
Dana\GF14491-PA 271 GF14491-PA 11..257 8..271 167 23.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23485-PA 101 GG23485-PA 1..94 181..274 430 85.1 Plus
Dere\GG23486-PA 281 GG23486-PA 10..277 4..270 406 33.7 Plus
Dere\GG21112-PA 287 GG21112-PA 21..271 6..269 202 27.3 Plus
Dere\GG21109-PA 293 GG21109-PA 18..279 11..272 190 26.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11462-PA 213 GH11462-PA 1..211 63..273 501 46 Plus
Dgri\GH11464-PA 279 GH11464-PA 12..277 2..269 409 32.2 Plus
Dgri\GH11461-PA 285 GH11461-PA 27..280 2..269 409 34.1 Plus
Dgri\GH11463-PA 280 GH11463-PA 12..277 2..269 369 33 Plus
Dgri\GH11205-PA 288 GH11205-PA 22..272 7..269 243 28.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Glyat-PA 278 CG34010-PA 3..278 1..276 1469 100 Plus
CG12560-PB 278 CG12560-PB 10..277 4..270 396 32.5 Plus
CG12560-PC 272 CG12560-PC 10..271 4..270 391 32.6 Plus
CG17681-PA 293 CG17681-PA 18..279 11..272 225 26 Plus
CG5783-PA 287 CG5783-PA 49..271 43..269 199 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16884-PA 213 GI16884-PA 5..212 67..274 431 46.6 Plus
Dmoj\GI16891-PA 265 GI16891-PA 11..264 4..270 372 30.7 Plus
Dmoj\GI18127-PA 287 GI18127-PA 21..271 6..269 213 26.2 Plus
Dmoj\GI18125-PA 292 GI18125-PA 17..277 12..271 209 27.4 Plus
Dmoj\GI18126-PA 285 GI18126-PA 127..271 128..271 201 29 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18505-PA 138 GL18505-PA 17..130 159..273 392 63.5 Plus
Dper\GL18506-PA 274 GL18506-PA 7..273 4..270 385 31.7 Plus
Dper\GL18696-PA 286 GL18696-PA 15..275 12..273 201 25.4 Plus
Dper\GL18695-PA 293 GL18695-PA 53..278 44..271 186 26.7 Plus
Dper\GL18697-PA 287 GL18697-PA 121..271 121..269 175 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25663-PA 286 GA25663-PA 62..285 67..270 286 33.6 Plus
Dpse\GA25759-PA 285 GA25759-PA 129..274 130..273 203 31.3 Plus
Dpse\GA14610-PA 293 GA14610-PA 19..278 12..271 187 25.6 Plus
Dpse\GA19124-PA 287 GA19124-PA 121..271 121..269 175 27.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13208-PA 161 GM13208-PA 1..161 116..276 792 90.1 Plus
Dsec\GM13211-PA 277 GM13211-PA 10..276 4..270 360 31.8 Plus
Dsec\GM17267-PA 291 GM17267-PA 16..277 11..272 210 25.7 Plus
Dsec\GM17269-PA 287 GM17269-PA 21..271 6..269 195 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22447-PA 103 GD22447-PA 1..103 174..276 508 92.2 Plus
Dsim\GD22448-PA 278 GD22448-PA 10..277 4..270 382 32.5 Plus
Dsim\GD24132-PA 395 GD24132-PA 18..279 11..272 206 25.3 Plus
Dsim\GD24134-PA 287 GD24134-PA 21..271 6..269 192 26.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17204-PA 352 GJ17204-PA 144..352 67..275 529 51.7 Plus
Dvir\GJ17205-PA 281 GJ17205-PA 14..279 4..269 393 33.7 Plus
Dvir\GJ17752-PA 287 GJ17752-PA 22..271 7..269 231 28.1 Plus
Dvir\GJ17751-PA 285 GJ17751-PA 124..269 125..269 228 32.2 Plus
Dvir\GJ17749-PA 292 GJ17749-PA 48..277 41..271 212 28.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15128-PA 339 GK15128-PA 12..337 4..271 342 27.9 Plus
Dwil\GK15539-PA 289 GK15539-PA 17..262 10..261 200 25.5 Plus
Dwil\GK15541-PA 288 GK15541-PA 132..272 130..269 199 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11230-PA 278 GE11230-PA 5..276 3..274 1232 83.8 Plus
Dyak\GE11235-PA 264 GE11235-PA 10..263 4..270 391 33.6 Plus
Dyak\GE11237-PA 278 GE11237-PA 10..277 4..270 368 31 Plus
Dyak\GE13183-PA 279 GE13183-PA 153..271 154..271 203 31.1 Plus
Dyak\GE13182-PA 293 GE13182-PA 18..279 11..272 194 25 Plus

IP17841.hyp Sequence

Translation from 0 to 830

> IP17841.hyp
PILIEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTD
TDWRTHGSYILIHYLENKAYIYMNTIKGTPEDLGKLLNSLKLKVFHLICG
YEERFKPLVEAYWLNLGQDLINLEHQGAIVYHLPSTEIPSWKPSLSTSCK
VAYITSNHAELVDKHWAYRSADSITMIRGFMENNLAVGVFDNQGEPLAWC
LRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVVPENE
GSQKMFEKLGFNNINKLYWAVIPCTL*

IP17841.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34010-PA 278 CG34010-PA 3..278 1..276 1469 100 Plus
CG12560-PB 278 CG12560-PB 10..277 4..270 396 32.5 Plus
CG12560-PC 272 CG12560-PC 10..271 4..270 391 32.6 Plus
CG17681-PA 293 CG17681-PA 18..279 11..272 225 26 Plus
CG5783-PA 287 CG5783-PA 49..271 43..269 199 26.9 Plus