BDGP Sequence Production Resources |
Search the DGRC for IP17848
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 178 |
Well: | 48 |
Vector: | pOT2 |
Associated Gene/Transcript | Rpb12-RA |
Protein status: | IP17848.pep: gold |
Sequenced Size: | 350 |
Gene | Date | Evidence |
---|---|---|
CG34186 | 2008-04-29 | Release 5.5 accounting |
CG34186 | 2008-08-15 | Release 5.9 accounting |
CG34186 | 2008-12-18 | 5.12 accounting |
350 bp assembled on 2007-01-16
GenBank Submission: BT030181
> IP17848.complete CAAAACAAAACACATTTTTACAGAAAACACGCTATAATTCGAATAATATT GATTAGAAATGTCGGAAACTAGCTCCAAGGATAATGTCAAAACGGCAATG ACCTATATTTGTGGAGAATGCCATCATGAAAACGAAATGCGCCCCAGGGA TCCGATTCGTTGTCGCGAGTGTGGATATCGTATCATGTACAAAAAGCGCA CCAAGCGTCTTGTTGTCTTTGATGCCCGTTAAAACCCCCTAAAAACCTAT AGACAACCGTCTAAACAATATATTTAAGCAGTTAGATTGTAAAAAATAAA GCTCTTGCTTTAATAAATGTCATAACCCCAAGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34186-RA | 605 | CG34186-RA | 93..426 | 1..334 | 1670 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 11032169..11032291 | 332..210 | 600 | 99.2 | Minus |
chr2R | 21145070 | chr2R | 11032584..11032699 | 116..1 | 580 | 100 | Minus |
chr2R | 21145070 | chr2R | 11032380..11032474 | 209..115 | 475 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 15144966..15145090 | 334..210 | 625 | 100 | Minus |
2R | 25286936 | 2R | 15145383..15145498 | 116..1 | 580 | 100 | Minus |
2R | 25286936 | 2R | 15145179..15145273 | 209..115 | 475 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 15146165..15146289 | 334..210 | 625 | 100 | Minus |
2R | 25260384 | 2R | 15146582..15146697 | 116..1 | 580 | 100 | Minus |
2R | 25260384 | 2R | 15146378..15146472 | 209..115 | 475 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 11032584..11032699 | 1..116 | 100 | Minus | |
chr2R | 11032169..11032291 | 210..332 | 99 | <- | Minus |
chr2R | 11032380..11032472 | 117..209 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34186-RA | 1..174 | 59..232 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34186-RA | 1..174 | 59..232 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb12-RA | 1..174 | 59..232 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34186-RA | 1..174 | 59..232 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb12-RA | 1..174 | 59..232 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34186-RA | 1..332 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34186-RA | 1..332 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb12-RA | 22..353 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34186-RA | 1..174 | 59..232 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb12-RA | 22..353 | 1..332 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15144968..15145090 | 210..332 | 100 | <- | Minus |
2R | 15145179..15145271 | 117..209 | 100 | <- | Minus |
2R | 15145383..15145498 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15144968..15145090 | 210..332 | 100 | <- | Minus |
2R | 15145179..15145271 | 117..209 | 100 | <- | Minus |
2R | 15145383..15145498 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15144968..15145090 | 210..332 | 100 | <- | Minus |
2R | 15145179..15145271 | 117..209 | 100 | <- | Minus |
2R | 15145383..15145498 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 11032473..11032595 | 210..332 | 100 | <- | Minus |
arm_2R | 11032684..11032776 | 117..209 | 100 | <- | Minus |
arm_2R | 11032888..11033003 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15146167..15146289 | 210..332 | 100 | <- | Minus |
2R | 15146378..15146470 | 117..209 | 100 | <- | Minus |
2R | 15146582..15146697 | 1..116 | 100 | Minus |
Translation from 58 to 231
> IP17848.hyp MSETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKR LVVFDAR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb12-PA | 57 | CG34186-PA | 1..57 | 1..57 | 313 | 100 | Plus |
Translation from 58 to 231
> IP17848.pep MSETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKR LVVFDAR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12628-PA | 591 | GF12628-PA | 554..591 | 20..57 | 204 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22374-PA | 57 | GG22374-PA | 1..57 | 1..57 | 301 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20797-PA | 57 | GH20797-PA | 1..57 | 1..57 | 297 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb12-PA | 57 | CG34186-PA | 1..57 | 1..57 | 313 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20882-PA | 57 | GI20882-PA | 1..57 | 1..57 | 297 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17021-PA | 57 | GL17021-PA | 1..57 | 1..57 | 297 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24334-PA | 57 | GA24334-PA | 1..57 | 1..57 | 297 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20158-PA | 57 | GM20158-PA | 1..57 | 1..57 | 301 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25636-PA | 57 | GD25636-PA | 1..57 | 1..57 | 301 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20617-PA | 57 | GJ20617-PA | 1..57 | 1..57 | 297 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19442-PA | 57 | GK19442-PA | 1..57 | 1..57 | 285 | 94.7 | Plus |
Dwil\GK19446-PA | 57 | GK19446-PA | 1..57 | 1..57 | 280 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12262-PA | 57 | GE12262-PA | 1..57 | 1..57 | 301 | 100 | Plus |