Clone IP17848 Report

Search the DGRC for IP17848

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:178
Well:48
Vector:pOT2
Associated Gene/TranscriptRpb12-RA
Protein status:IP17848.pep: gold
Sequenced Size:350

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34186 2008-04-29 Release 5.5 accounting
CG34186 2008-08-15 Release 5.9 accounting
CG34186 2008-12-18 5.12 accounting

Clone Sequence Records

IP17848.complete Sequence

350 bp assembled on 2007-01-16

GenBank Submission: BT030181

> IP17848.complete
CAAAACAAAACACATTTTTACAGAAAACACGCTATAATTCGAATAATATT
GATTAGAAATGTCGGAAACTAGCTCCAAGGATAATGTCAAAACGGCAATG
ACCTATATTTGTGGAGAATGCCATCATGAAAACGAAATGCGCCCCAGGGA
TCCGATTCGTTGTCGCGAGTGTGGATATCGTATCATGTACAAAAAGCGCA
CCAAGCGTCTTGTTGTCTTTGATGCCCGTTAAAACCCCCTAAAAACCTAT
AGACAACCGTCTAAACAATATATTTAAGCAGTTAGATTGTAAAAAATAAA
GCTCTTGCTTTAATAAATGTCATAACCCCAAGAAAAAAAAAAAAAAAAAA

IP17848.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34186-RA 605 CG34186-RA 93..426 1..334 1670 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11032169..11032291 332..210 600 99.2 Minus
chr2R 21145070 chr2R 11032584..11032699 116..1 580 100 Minus
chr2R 21145070 chr2R 11032380..11032474 209..115 475 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15144966..15145090 334..210 625 100 Minus
2R 25286936 2R 15145383..15145498 116..1 580 100 Minus
2R 25286936 2R 15145179..15145273 209..115 475 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15146165..15146289 334..210 625 100 Minus
2R 25260384 2R 15146582..15146697 116..1 580 100 Minus
2R 25260384 2R 15146378..15146472 209..115 475 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:48:00 has no hits.

IP17848.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:48:45 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11032584..11032699 1..116 100   Minus
chr2R 11032169..11032291 210..332 99 <- Minus
chr2R 11032380..11032472 117..209 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:10:15 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
CG34186-RA 1..174 59..232 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:36 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
CG34186-RA 1..174 59..232 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:57 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb12-RA 1..174 59..232 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:17 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
CG34186-RA 1..174 59..232 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:10 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb12-RA 1..174 59..232 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:21 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
CG34186-RA 1..332 1..332 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:35 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
CG34186-RA 1..332 1..332 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:57 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb12-RA 22..353 1..332 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:17 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
CG34186-RA 1..174 59..232 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:10 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb12-RA 22..353 1..332 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:45 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15144968..15145090 210..332 100 <- Minus
2R 15145179..15145271 117..209 100 <- Minus
2R 15145383..15145498 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:45 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15144968..15145090 210..332 100 <- Minus
2R 15145179..15145271 117..209 100 <- Minus
2R 15145383..15145498 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:45 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15144968..15145090 210..332 100 <- Minus
2R 15145179..15145271 117..209 100 <- Minus
2R 15145383..15145498 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:57 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11032473..11032595 210..332 100 <- Minus
arm_2R 11032684..11032776 117..209 100 <- Minus
arm_2R 11032888..11033003 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:20 Download gff for IP17848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15146167..15146289 210..332 100 <- Minus
2R 15146378..15146470 117..209 100 <- Minus
2R 15146582..15146697 1..116 100   Minus

IP17848.hyp Sequence

Translation from 58 to 231

> IP17848.hyp
MSETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKR
LVVFDAR*

IP17848.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb12-PA 57 CG34186-PA 1..57 1..57 313 100 Plus

IP17848.pep Sequence

Translation from 58 to 231

> IP17848.pep
MSETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKR
LVVFDAR*

IP17848.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12628-PA 591 GF12628-PA 554..591 20..57 204 97.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22374-PA 57 GG22374-PA 1..57 1..57 301 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20797-PA 57 GH20797-PA 1..57 1..57 297 98.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb12-PA 57 CG34186-PA 1..57 1..57 313 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20882-PA 57 GI20882-PA 1..57 1..57 297 98.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17021-PA 57 GL17021-PA 1..57 1..57 297 98.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24334-PA 57 GA24334-PA 1..57 1..57 297 98.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20158-PA 57 GM20158-PA 1..57 1..57 301 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25636-PA 57 GD25636-PA 1..57 1..57 301 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20617-PA 57 GJ20617-PA 1..57 1..57 297 98.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19442-PA 57 GK19442-PA 1..57 1..57 285 94.7 Plus
Dwil\GK19446-PA 57 GK19446-PA 1..57 1..57 280 93 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12262-PA 57 GE12262-PA 1..57 1..57 301 100 Plus