Clone IP17849 Report

Search the DGRC for IP17849

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:178
Well:49
Vector:pOT2
Associated Gene/TranscriptCG34188-RA
Protein status:IP17849.pep: gold
Sequenced Size:820

Clone Sequence Records

IP17849.complete Sequence

820 bp assembled on 2009-06-16

GenBank Submission: BT088828.1

> IP17849.complete
GATGGCGTATATTCGAAATTTTCTGAATTCCCCCAATGACTGGACCCGAC
TTAATGAAAATATCAATGGAATAAAGCCACTGAATAGCTGCTTTTATTTC
TTCAGCTTGAAAACGGGCTGCAATTTGATCGCCGGATTCGAAGCATTGGT
AAATGTGCTACAAATGTGCAGCATTTACTTGTCGGAGATGGAGGTCAAGA
CCACAATCACAACTACGGAGTCACCGGATTCGATGCTTGTCACTAGGGAA
CCGGACGGAGATATGCTGGGACCCAACATGAGAACGCCTATGTTTGAAAC
TAACCTCTTCTTCCAAAAAGCACTAATCTCGTTGACTATCTTCAGATCAG
TGCTACTTATTGTAGGTGCAGAATGGAGTCACATATCCTGTCTCGTCCTT
TGGATTTGTATTACGGTTATAACCTTGTTAATTAGCACTTGTAATGATAT
CATGCAAGATGACGAGCTGCTGACTTTTCTCTTTTCTACCATTTCTATTT
TTCTTGAAATCTATTTCTGCGCAGTGGTTGCCTCCTTGGTTTTGAAATTG
CAGCAAAAACTTCGTCGTAACGTGCAGGAATCGGAAGTGCTGTTCACACG
AATGGAGGAAGTTTAATTAAATTCAAGATAATTAAACTATACATTTAAAT
TTGCAAGCTCCTACTTACAATTATTTAATTTTTACTTGTGTTGTTGCATT
CCCAAATTGAAAAAGCATGTACTCATAATAATTTGGAAAAAAATACACAA
TATACTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
TAAAAAAAAAAAAAAAAAAA

IP17849.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34188-RA 1022 CG34188-RA 248..1007 1..760 3800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11314721..11315096 376..1 1835 99.2 Minus
chr2R 21145070 chr2R 11314210..11314469 760..501 1300 100 Minus
chr2R 21145070 chr2R 11314544..11314668 500..376 625 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15427600..15427975 376..1 1880 100 Minus
2R 25286936 2R 15427089..15427348 760..501 1300 100 Minus
2R 25286936 2R 15427423..15427547 500..376 625 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15428799..15429174 376..1 1880 100 Minus
2R 25260384 2R 15428288..15428547 760..501 1300 100 Minus
2R 25260384 2R 15428622..15428746 500..376 625 100 Minus
Blast to na_te.dros performed 2019-03-15 21:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 711..781 609..682 146 70.3 Plus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 5866..5985 746..626 124 60.2 Minus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 749..795 601..648 111 72.9 Plus

IP17849.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:14:07 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11314212..11314469 501..758 100 <- Minus
chr2R 11314544..11314667 377..500 100 <- Minus
chr2R 11314721..11315096 1..376 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:36 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:01 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:40:16 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:46:07 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-16 09:46:46 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 49..664 1..616 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:01 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 49..806 1..758 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:40:16 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 49..806 1..758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:46:07 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
CG34188-RA 49..806 1..758 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:07 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15427091..15427348 501..758 100 <- Minus
2R 15427423..15427546 377..500 100 <- Minus
2R 15427600..15427975 1..376 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:07 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15427091..15427348 501..758 100 <- Minus
2R 15427423..15427546 377..500 100 <- Minus
2R 15427600..15427975 1..376 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:14:07 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15427091..15427348 501..758 100 <- Minus
2R 15427423..15427546 377..500 100 <- Minus
2R 15427600..15427975 1..376 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:40:16 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11314596..11314853 501..758 100 <- Minus
arm_2R 11314928..11315051 377..500 100 <- Minus
arm_2R 11315105..11315480 1..376 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:33 Download gff for IP17849.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15428290..15428547 501..758 100 <- Minus
2R 15428622..15428745 377..500 100 <- Minus
2R 15428799..15429174 1..376 100   Minus

IP17849.hyp Sequence

Translation from 0 to 615

> IP17849.hyp
MAYIRNFLNSPNDWTRLNENINGIKPLNSCFYFFSLKTGCNLIAGFEALV
NVLQMCSIYLSEMEVKTTITTTESPDSMLVTREPDGDMLGPNMRTPMFET
NLFFQKALISLTIFRSVLLIVGAEWSHISCLVLWICITVITLLISTCNDI
MQDDELLTFLFSTISIFLEIYFCAVVASLVLKLQQKLRRNVQESEVLFTR
MEEV*

IP17849.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34188-PA 204 CG34188-PA 1..204 1..204 1046 100 Plus
CG30472-PB 212 CG30472-PB 19..185 14..186 282 39.1 Plus

IP17849.pep Sequence

Translation from 1 to 615

> IP17849.pep
MAYIRNFLNSPNDWTRLNENINGIKPLNSCFYFFSLKTGCNLIAGFEALV
NVLQMCSIYLSEMEVKTTITTTESPDSMLVTREPDGDMLGPNMRTPMFET
NLFFQKALISLTIFRSVLLIVGAEWSHISCLVLWICITVITLLISTCNDI
MQDDELLTFLFSTISIFLEIYFCAVVASLVLKLQQKLRRNVQESEVLFTR
MEEV*

IP17849.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11869-PA 210 GF11869-PA 1..120 1..125 196 39.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22353-PA 150 GG22353-PA 1..89 42..137 309 64.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34188-PA 204 CG34188-PA 1..204 1..204 1046 100 Plus
CG30472-PB 212 CG30472-PB 19..185 14..186 282 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20042-PA 244 GL20042-PA 39..134 27..124 155 39 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20139-PA 108 GM20139-PA 6..81 111..186 155 42.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25617-PA 108 GD25617-PA 6..81 111..186 151 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14153-PA 204 GE14153-PA 1..204 1..204 830 80.9 Plus