Clone IP17896 Report

Search the DGRC for IP17896

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:178
Well:96
Vector:pOT2
Associated Gene/TranscriptCG17574-RG
Protein status:IP17896.pep: gold
Sequenced Size:940

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17574 2008-04-29 Release 5.5 accounting
CG17574 2008-08-15 Release 5.9 accounting
CG17574 2008-12-18 5.12 accounting

Clone Sequence Records

IP17896.complete Sequence

940 bp assembled on 2007-01-16

GenBank Submission: BT029967

> IP17896.complete
AGCGATTGTGTTTTTTCGAGCTAAATTCCCTGACTTATCGAGAATGTGGG
CATTCTGGGTTGGATTATCTATAGCCTTTGCCATATTTTTCATTACTTCC
TTCGTTGTTTGCATTAGACGCAGGCAGAAAGCAGCGCGAAATGTTGGCTA
CACAATCAGCGAAGGCGTTGCGCCTGTGGTGGTGACCTCCGCCACCCACA
CGGCTCCCGGCGGATATCCGGTCACACAGCTGCCTCCGCCGGGCTATCCA
TCGAGCAATGCCTACGTAACTGCGACCTCGTACCCCGTACAGACCACCGG
CAACGTGACTGTGCAGATGCCCATGCCGATGAGCCACCAGAACCAGCAGC
AAATGCCAATGCCTATGCCGATGCCGGGTCAGCAAACGCATGGCGTGGCG
TATCCGACGTATCCTGGCGCCGGGGCTGCCAACATGAATCCGCCGCCGTA
TGACATGTCCATGGCTAATCCAGGACCTAGTGTTATGCCCGCTGGATATG
AGAAGCAAGCTCCCTACAATCCCCACTTTGGCCAGTGAAATCGCACTGTG
AACTGAGGATCCCCTTTCCGTCTCGTTATAGCTTTTTTACTCAGCTGAAC
ACTTTACTTTCCATGTTTTCTTGCATAAAAAACTCCAAACTCCTGGTAAA
AAACCAAGTGAAAGCGATCGCACAACGAGCCATTTTTATATTCCATGTGA
TGTATGTAAAGTGTACATATAACTTAAGCGCAACCTTCTATTTATACATC
TATATTAAGCAAATCCAAAACGAAAACCAAACTGAACTACATGAAGTGTT
AATTGTAATAAACCAGTGAAGTGCACATCAAATGCAACTGAAGCACATTT
GTTTCGATGTGCACTTTCACAAAATCACAAAAACAAGAAATGCAAACATG
TTTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP17896.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17574-RB 1207 CG17574-RB 291..1197 1..907 4535 100 Plus
CG17574.c 816 CG17574.c 69..806 170..907 3690 100 Plus
CG17574-RD 841 CG17574-RD 94..831 170..907 3690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8736670..8737197 905..378 2640 100 Minus
chr2R 21145070 chr2R 8738075..8738244 170..1 850 100 Minus
chr2R 21145070 chr2R 8744733..8744902 170..1 835 99.4 Minus
chr2R 21145070 chr2R 8737399..8737529 300..170 655 100 Minus
chr2R 21145070 chr2R 8737261..8737339 378..300 395 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12849368..12849897 907..378 2650 100 Minus
2R 25286936 2R 12850775..12850944 170..1 850 100 Minus
2R 25286936 2R 12857433..12857602 170..1 835 99.4 Minus
2R 25286936 2R 12850099..12850229 300..170 655 100 Minus
2R 25286936 2R 12849961..12850039 378..300 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12850567..12851096 907..378 2650 100 Minus
2R 25260384 2R 12851974..12852143 170..1 850 100 Minus
2R 25260384 2R 12858632..12858801 170..1 835 99.4 Minus
2R 25260384 2R 12851298..12851428 300..170 655 100 Minus
2R 25260384 2R 12851160..12851238 378..300 395 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:39:15 has no hits.

IP17896.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:40:26 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8736670..8737196 379..905 100 <- Minus
chr2R 8737261..8737338 301..378 100 <- Minus
chr2R 8737399..8737528 171..300 100 <- Minus
chr2R 8738075..8738244 1..170 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:10:28 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RB 291..828 1..538 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:09:07 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RB 291..828 1..538 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:35 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RG 1..495 44..538 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:19:25 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RB 291..828 1..538 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:07:43 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RG 1..495 44..538 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:38:04 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RB 291..1195 1..905 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:09:07 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RB 291..1195 1..905 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:35 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RG 5..909 1..905 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:19:25 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RB 291..1195 1..905 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:07:43 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RG 5..909 1..905 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:26 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12850775..12850944 1..170 100   Minus
2R 12849370..12849896 379..905 100 <- Minus
2R 12849961..12850038 301..378 100 <- Minus
2R 12850099..12850228 171..300 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:26 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12850775..12850944 1..170 100   Minus
2R 12849370..12849896 379..905 100 <- Minus
2R 12849961..12850038 301..378 100 <- Minus
2R 12850099..12850228 171..300 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:26 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12850775..12850944 1..170 100   Minus
2R 12849370..12849896 379..905 100 <- Minus
2R 12849961..12850038 301..378 100 <- Minus
2R 12850099..12850228 171..300 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:35 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8736875..8737401 379..905 100 <- Minus
arm_2R 8737466..8737543 301..378 100 <- Minus
arm_2R 8737604..8737733 171..300 100 <- Minus
arm_2R 8738280..8738449 1..170 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:41:41 Download gff for IP17896.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12850569..12851095 379..905 100 <- Minus
2R 12851160..12851237 301..378 100 <- Minus
2R 12851298..12851427 171..300 100 <- Minus
2R 12851974..12852143 1..170 100   Minus

IP17896.hyp Sequence

Translation from 0 to 537

> IP17896.hyp
AIVFFRAKFPDLSRMWAFWVGLSIAFAIFFITSFVVCIRRRQKAARNVGY
TISEGVAPVVVTSATHTAPGGYPVTQLPPPGYPSSNAYVTATSYPVQTTG
NVTVQMPMPMSHQNQQQMPMPMPMPGQQTHGVAYPTYPGAGAANMNPPPY
DMSMANPGPSVMPAGYEKQAPYNPHFGQ*

IP17896.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17574-PG 164 CG17574-PG 1..164 15..178 896 100 Plus
CG17574-PF 162 CG17574-PF 7..162 18..178 716 82.6 Plus
CG17574-PK 153 CG17574-PK 2..153 28..178 700 85.5 Plus
CG17574-PA 156 CG17574-PA 8..156 28..178 684 81.6 Plus
CG17574-PL 157 CG17574-PL 9..157 24..178 681 81.9 Plus

IP17896.pep Sequence

Translation from 1 to 537

> IP17896.pep
AIVFFRAKFPDLSRMWAFWVGLSIAFAIFFITSFVVCIRRRQKAARNVGY
TISEGVAPVVVTSATHTAPGGYPVTQLPPPGYPSSNAYVTATSYPVQTTG
NVTVQMPMPMSHQNQQQMPMPMPMPGQQTHGVAYPTYPGAGAANMNPPPY
DMSMANPGPSVMPAGYEKQAPYNPHFGQ*

IP17896.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12001-PA 156 GF12001-PA 2..156 14..178 408 58.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22545-PA 152 GG22545-PA 4..152 16..178 515 66.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23912-PA 149 GH23912-PA 6..149 24..178 304 47.3 Plus
Dgri\GH20128-PA 153 GH20128-PA 4..153 16..178 279 49.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17574-PG 164 CG17574-PG 1..164 15..178 896 100 Plus
CG17574-PF 162 CG17574-PF 7..162 18..178 716 82.6 Plus
CG17574-PK 153 CG17574-PK 2..153 28..178 700 85.5 Plus
CG17574-PA 156 CG17574-PA 8..156 28..178 684 81.6 Plus
CG17574-PH 174 CG17574-PH 37..174 38..178 682 90.8 Plus
CG17574-PL 157 CG17574-PL 9..157 24..178 681 81.9 Plus
CG17574-PE 174 CG17574-PE 38..174 41..178 679 90.6 Plus
CG17574-PI 175 CG17574-PI 54..175 57..178 678 100 Plus
CG17574-PJ 157 CG17574-PJ 8..157 28..178 672 81.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20218-PA 153 GI20218-PA 2..153 14..178 271 50.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17453-PA 151 GL17453-PA 2..151 14..178 412 61.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14562-PD 155 GA14562-PD 1..155 15..178 529 73.8 Plus
Dpse\GA14562-PB 155 GA14562-PB 7..155 18..178 427 64.6 Plus
Dpse\GA14562-PC 167 GA14562-PC 17..167 15..178 405 61.6 Plus
Dpse\GA14562-PA 149 GA14562-PA 2..149 14..178 403 61.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20330-PA 201 GM20330-PA 31..201 1..178 533 73.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25807-PA 201 GD25807-PA 31..201 1..178 539 74.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20168-PA 150 GJ20168-PA 4..150 16..178 339 51.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20881-PA 142 GK20881-PA 4..142 16..178 298 51.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13415-PA 154 GE13415-PA 2..154 14..178 443 70.3 Plus