Clone IP17990 Report

Search the DGRC for IP17990

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:179
Well:90
Vector:pOT2
Associated Gene/TranscriptCG34229-RA
Protein status:IP17990.pep: gold
Sequenced Size:482

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34229 2008-04-29 Release 5.5 accounting
CG34229 2008-08-15 Release 5.9 accounting
CG34229 2008-12-18 5.12 accounting

Clone Sequence Records

IP17990.complete Sequence

482 bp assembled on 2007-01-15

GenBank Submission: BT030195

> IP17990.complete
AAATGACAGAATAACTTGAAAACTAAAAGAATAACTAATAATAATAATTC
AACTAGAAAATATAAAGAAAAAAAAAACAATTAAGCAGAAATGTCCAAGT
TACCAAAAGCATCACTTAGTTTGAAGCAGTTTATGCTGCGCCAGGAAGTA
CTGAAGCTCTACCGGGAAATATTTCGAACGATTCGTCAGGTTCCCGACAA
AAACAGCCAGCTGGAGCTAAAATCCTGGGCACGGCATGACTTCCAGACGA
ATCGCCATCAAAGTGACGAGGTGGCCATCAAGATGCTCCTTCAGCACGGC
AGACGCAGCCTCACAGAACTAAGGACCAGCCTCCAACTGAGCGGGGTGAG
CGAGGGCAAATAGGATCAGTCTTGAACATAAATCTTAGCTTAATTTGATT
TTATTTTTGAGCTCGACAACCGTACGAAAATAAATACGAGTTAAGACTAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP17990.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-RA 461 CG34229-RA 50..461 1..413 2025 99.7 Plus
S2P.a 1958 S2P.a 1893..1958 450..385 330 100 Minus
S2P-RA 2121 S2P-RA 2056..2121 450..385 330 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7729120..7729440 128..448 1590 99.7 Plus
chr2R 21145070 chr2R 7728911..7729038 1..129 520 95.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11841844..11842166 128..450 1615 100 Plus
2R 25286936 2R 11841635..11841762 1..129 595 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11843043..11843365 128..450 1615 100 Plus
2R 25260384 2R 11842834..11842961 1..129 605 99.2 Plus
Blast to na_te.dros performed on 2019-03-15 21:56:52 has no hits.

IP17990.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:57:43 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7728911..7729038 1..129 95 -> Plus
chr2R 7729122..7729440 130..448 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:10:52 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..273 91..363 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:58 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..273 91..363 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:02:27 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..273 91..363 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:22:04 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..273 91..363 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:35 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..273 91..363 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:40:51 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..273 91..363 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:58 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 28..474 1..448 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:02:27 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 28..474 1..448 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:22:04 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..273 91..363 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:35 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 28..474 1..448 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:43 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11841635..11841762 1..129 99 -> Plus
2R 11841846..11842164 130..448 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:43 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11841635..11841762 1..129 99 -> Plus
2R 11841846..11842164 130..448 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:43 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11841635..11841762 1..129 99 -> Plus
2R 11841846..11842164 130..448 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:02:27 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7729140..7729267 1..129 99 -> Plus
arm_2R 7729351..7729669 130..448 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:42 Download gff for IP17990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11842834..11842961 1..129 99 -> Plus
2R 11843045..11843363 130..448 100   Plus

IP17990.hyp Sequence

Translation from 90 to 362

> IP17990.hyp
MSKLPKASLSLKQFMLRQEVLKLYREIFRTIRQVPDKNSQLELKSWARHD
FQTNRHQSDEVAIKMLLQHGRRSLTELRTSLQLSGVSEGK*

IP17990.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-PA 90 CG34229-PA 1..90 1..90 448 100 Plus

IP17990.pep Sequence

Translation from 90 to 362

> IP17990.pep
MSKLPKASLSLKQFMLRQEVLKLYREIFRTIRQVPDKNSQLELKSWARHD
FQTNRHQSDEVAIKMLLQHGRRSLTELRTSLQLSGVSEGK*

IP17990.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11459-PA 90 GF11459-PA 1..90 1..90 416 87.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20221-PA 90 GG20221-PA 1..90 1..90 462 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22903-PA 92 GH22903-PA 1..86 1..86 352 81.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-PA 90 CG34229-PA 1..90 1..90 448 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18388-PA 89 GI18388-PA 1..87 1..87 358 79.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10087-PA 91 GL10087-PA 1..88 1..88 402 85.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25068-PA 91 GA25068-PA 1..88 1..88 406 86.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21307-PA 90 GM21307-PA 1..90 1..90 462 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10816-PA 90 GD10816-PA 1..90 1..90 462 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21465-PA 93 GJ21465-PA 1..87 1..87 354 79.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17885-PA 91 GK17885-PA 1..90 1..90 403 85.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12382-PA 90 GE12382-PA 1..90 1..90 460 98.9 Plus