BDGP Sequence Production Resources |
Search the DGRC for IP17990
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 179 |
Well: | 90 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34229-RA |
Protein status: | IP17990.pep: gold |
Sequenced Size: | 482 |
Gene | Date | Evidence |
---|---|---|
CG34229 | 2008-04-29 | Release 5.5 accounting |
CG34229 | 2008-08-15 | Release 5.9 accounting |
CG34229 | 2008-12-18 | 5.12 accounting |
482 bp assembled on 2007-01-15
GenBank Submission: BT030195
> IP17990.complete AAATGACAGAATAACTTGAAAACTAAAAGAATAACTAATAATAATAATTC AACTAGAAAATATAAAGAAAAAAAAAACAATTAAGCAGAAATGTCCAAGT TACCAAAAGCATCACTTAGTTTGAAGCAGTTTATGCTGCGCCAGGAAGTA CTGAAGCTCTACCGGGAAATATTTCGAACGATTCGTCAGGTTCCCGACAA AAACAGCCAGCTGGAGCTAAAATCCTGGGCACGGCATGACTTCCAGACGA ATCGCCATCAAAGTGACGAGGTGGCCATCAAGATGCTCCTTCAGCACGGC AGACGCAGCCTCACAGAACTAAGGACCAGCCTCCAACTGAGCGGGGTGAG CGAGGGCAAATAGGATCAGTCTTGAACATAAATCTTAGCTTAATTTGATT TTATTTTTGAGCTCGACAACCGTACGAAAATAAATACGAGTTAAGACTAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7728911..7729038 | 1..129 | 95 | -> | Plus |
chr2R | 7729122..7729440 | 130..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 1..273 | 91..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 1..273 | 91..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 1..273 | 91..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 1..273 | 91..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 1..273 | 91..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 1..273 | 91..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 28..474 | 1..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 28..474 | 1..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 1..273 | 91..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34229-RA | 28..474 | 1..448 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11841635..11841762 | 1..129 | 99 | -> | Plus |
2R | 11841846..11842164 | 130..448 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11841635..11841762 | 1..129 | 99 | -> | Plus |
2R | 11841846..11842164 | 130..448 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11841635..11841762 | 1..129 | 99 | -> | Plus |
2R | 11841846..11842164 | 130..448 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7729140..7729267 | 1..129 | 99 | -> | Plus |
arm_2R | 7729351..7729669 | 130..448 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11842834..11842961 | 1..129 | 99 | -> | Plus |
2R | 11843045..11843363 | 130..448 | 100 | Plus |
Translation from 90 to 362
> IP17990.hyp MSKLPKASLSLKQFMLRQEVLKLYREIFRTIRQVPDKNSQLELKSWARHD FQTNRHQSDEVAIKMLLQHGRRSLTELRTSLQLSGVSEGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34229-PA | 90 | CG34229-PA | 1..90 | 1..90 | 448 | 100 | Plus |
Translation from 90 to 362
> IP17990.pep MSKLPKASLSLKQFMLRQEVLKLYREIFRTIRQVPDKNSQLELKSWARHD FQTNRHQSDEVAIKMLLQHGRRSLTELRTSLQLSGVSEGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11459-PA | 90 | GF11459-PA | 1..90 | 1..90 | 416 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20221-PA | 90 | GG20221-PA | 1..90 | 1..90 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22903-PA | 92 | GH22903-PA | 1..86 | 1..86 | 352 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34229-PA | 90 | CG34229-PA | 1..90 | 1..90 | 448 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18388-PA | 89 | GI18388-PA | 1..87 | 1..87 | 358 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10087-PA | 91 | GL10087-PA | 1..88 | 1..88 | 402 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25068-PA | 91 | GA25068-PA | 1..88 | 1..88 | 406 | 86.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21307-PA | 90 | GM21307-PA | 1..90 | 1..90 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10816-PA | 90 | GD10816-PA | 1..90 | 1..90 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21465-PA | 93 | GJ21465-PA | 1..87 | 1..87 | 354 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17885-PA | 91 | GK17885-PA | 1..90 | 1..90 | 403 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12382-PA | 90 | GE12382-PA | 1..90 | 1..90 | 460 | 98.9 | Plus |