Clone IP18003 Report

Search the DGRC for IP18003

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:180
Well:3
Vector:pOT2
Associated Gene/TranscriptCG34236-RB
Protein status:IP18003.pep: gold
Sequenced Size:633

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34236 2008-04-29 Release 5.5 accounting
CG34236 2008-08-15 Release 5.9 accounting
CG34236 2008-12-18 5.12 accounting

Clone Sequence Records

IP18003.complete Sequence

633 bp assembled on 2007-01-15

GenBank Submission: BT030197

> IP18003.complete
ACGAACCGTCCACTCGAAAAATATAGCAGAATATATTCGCCGAAAATAAA
CAATCTTATATCTTATCGGCAATGCCACTGAAATTTCATAGATTGCTGCT
GCCGCTGCTCCTGTTCGCTTCTCAACTGCTGGCTGAAATTCCGCAGTGCT
TTCACTTCACCTGGCTTGGTGCCTACTCGAATCACTCGAACATTCACACG
GAAACCTGTGAGTCCAGAGTTGGTGACTTTAATGAAATACCCTGCGCAGA
ACCATTGGTTGTGACACCCGAAGATACAGTGCCGGATGTAAAGGCTCTGT
GGCAGAATAATACCGAGGATCGCGACAACTATCTGTGCCAAATGTCGCCG
GGTCGTTCATGTGTGAAATACTCGTACATATTCAAAGGCGGAATACAAAA
CATCACGTACATGTGCGCCAATGTAAACAGCACCAACGGATGCTATCGAC
AGACCCACCCAAGTGGTATGGTTGTGGAGGCATGTGTCTGCACCTCCCGG
GTGGGCTTGATACCCTGTAATGGCTGCTCGAAGTCGCAGTGTGCTGTGCT
GGGCTGGGCACTTTGTTTGTACGGCCTTTATCAATGGCTAAATAAATATC
GCATAGTTTGAACTGCAAAAAAAAAAAAAAAAA

IP18003.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34236-RB 771 CG34236-RB 67..685 1..619 3095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9491875..9492097 616..394 1115 100 Minus
chr2R 21145070 chr2R 9492569..9492706 138..1 690 100 Minus
chr2R 21145070 chr2R 9492364..9492492 267..139 645 100 Minus
chr2R 21145070 chr2R 9492165..9492290 393..268 630 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13604571..13604796 619..394 1130 100 Minus
2R 25286936 2R 13605268..13605405 138..1 690 100 Minus
2R 25286936 2R 13605063..13605191 267..139 645 100 Minus
2R 25286936 2R 13604864..13604989 393..268 630 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13605770..13605995 619..394 1130 100 Minus
2R 25260384 2R 13606467..13606604 138..1 690 100 Minus
2R 25260384 2R 13606262..13606390 267..139 645 100 Minus
2R 25260384 2R 13606063..13606188 393..268 630 100 Minus
Blast to na_te.dros performed 2019-03-16 21:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 830..863 416..450 109 82.9 Plus

IP18003.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:30:43 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9491875..9492097 394..616 100 <- Minus
chr2R 9492165..9492290 268..393 100 <- Minus
chr2R 9492364..9492492 139..267 100 <- Minus
chr2R 9492569..9492706 1..138 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:10:55 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RA 1..436 72..508 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:02 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RB 1..540 72..611 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:22 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RB 1..540 72..611 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:22:11 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RA 1..436 72..508 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:20:16 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RB 1..540 72..611 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:40:54 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RA 1..436 72..508 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:01 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RB 1..616 1..616 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:22 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RB 1..616 1..616 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:22:11 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RA 1..436 72..508 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:20:16 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
CG34236-RB 31..646 1..616 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:43 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13604574..13604796 394..616 100 <- Minus
2R 13604864..13604989 268..393 100 <- Minus
2R 13605063..13605191 139..267 100 <- Minus
2R 13605268..13605405 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:43 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13604574..13604796 394..616 100 <- Minus
2R 13604864..13604989 268..393 100 <- Minus
2R 13605063..13605191 139..267 100 <- Minus
2R 13605268..13605405 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:43 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13604574..13604796 394..616 100 <- Minus
2R 13604864..13604989 268..393 100 <- Minus
2R 13605063..13605191 139..267 100 <- Minus
2R 13605268..13605405 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:22 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9492369..9492494 268..393 100 <- Minus
arm_2R 9492568..9492696 139..267 100 <- Minus
arm_2R 9492773..9492910 1..138 100   Minus
arm_2R 9492079..9492301 394..616 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:44 Download gff for IP18003.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13605773..13605995 394..616 100 <- Minus
2R 13606063..13606188 268..393 100 <- Minus
2R 13606262..13606390 139..267 100 <- Minus
2R 13606467..13606604 1..138 100   Minus

IP18003.pep Sequence

Translation from 71 to 610

> IP18003.pep
MPLKFHRLLLPLLLFASQLLAEIPQCFHFTWLGAYSNHSNIHTETCESRV
GDFNEIPCAEPLVVTPEDTVPDVKALWQNNTEDRDNYLCQMSPGRSCVKY
SYIFKGGIQNITYMCANVNSTNGCYRQTHPSGMVVEACVCTSRVGLIPCN
GCSKSQCAVLGWALCLYGLYQWLNKYRIV*

IP18003.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22476-PA 139 GG22476-PA 1..137 1..137 659 92.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20872-PA 290 GH20872-PA 139..282 24..166 574 72.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34236-PC 179 CG34236-PC 1..179 1..179 997 100 Plus
CG34236-PB 179 CG34236-PB 1..179 1..179 997 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20983-PA 174 GI20983-PA 20..170 21..170 572 69.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17004-PA 181 GL17004-PA 1..181 1..179 707 78.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24993-PA 181 GA24993-PA 1..181 1..179 709 77.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20260-PA 179 GM20260-PA 1..179 1..179 871 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25746-PA 175 GD25746-PA 1..159 1..159 781 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20703-PA 176 GJ20703-PA 22..172 21..170 583 70.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13346-PA 230 GE13346-PA 1..136 8..143 642 86 Plus

IP18003.hyp Sequence

Translation from 71 to 610

> IP18003.hyp
MPLKFHRLLLPLLLFASQLLAEIPQCFHFTWLGAYSNHSNIHTETCESRV
GDFNEIPCAEPLVVTPEDTVPDVKALWQNNTEDRDNYLCQMSPGRSCVKY
SYIFKGGIQNITYMCANVNSTNGCYRQTHPSGMVVEACVCTSRVGLIPCN
GCSKSQCAVLGWALCLYGLYQWLNKYRIV*

IP18003.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34236-PC 179 CG34236-PC 1..179 1..179 997 100 Plus
CG34236-PB 179 CG34236-PB 1..179 1..179 997 100 Plus