Clone IP18013 Report

Search the DGRC for IP18013

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:180
Well:13
Vector:pOT2
Associated Gene/TranscriptCG34241-RA
Protein status:IP18013.pep: gold
Sequenced Size:430

Clone Sequence Records

IP18013.complete Sequence

430 bp assembled on 2009-01-21

GenBank Submission: BT058013.1

> IP18013.complete
TTTCTTTTCATATCTTTCGAGTAACCGGACAAAATCATTGAAAAATTTCT
AAATTTTCAAAATTTGTTTATTTCGAATATAAAAGTTTTTTAACCATGGA
TAGGGGTACGTCTTCAAATCAGCCCATCCTGACCACCTGTGAGATGTATC
CGCGCCGAAGGAACACGGAGTTCTACAGATCCCCGGAACCGAGAGTCTCC
TGCCAAAACCAACGAGCGGAACATCCGGGGCAGATGCTCAACGTGACTCC
CGACGAGAATCGGGAGGCCGTACGAAGACTTCCACGAATCCAGCCGCCAA
ATAATTTGGATAGTGTTTATCTACGCAATGGTTACTTTTCGTAAAATAAA
TTTTGTAGATTCTGTGTAAACTAAAATAAAGATATGTACGTATAGATATA
CTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP18013.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34241-RA 492 CG34241-RA 51..454 1..404 2020 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12118937..12119213 126..402 1385 100 Plus
chr3L 24539361 chr3L 12118759..12118880 4..125 610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12128185..12128463 126..404 1395 100 Plus
3L 28110227 3L 12128004..12128128 1..125 625 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12121285..12121563 126..404 1395 100 Plus
3L 28103327 3L 12121104..12121228 1..125 625 100 Plus
Blast to na_te.dros performed 2019-03-16 20:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1270..1348 298..382 113 64.7 Plus

IP18013.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:58:37 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12118756..12118880 1..125 99 -> Plus
chr3L 12118937..12119213 126..402 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:42 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 1..249 96..344 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:09 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 1..249 96..344 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:15 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 1..249 96..344 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:00:57 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 1..249 96..344 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-21 17:55:51 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 1..380 21..400 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:09 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 1..380 21..400 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:15 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 26..427 1..402 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:00:57 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 26..427 1..402 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:37 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12128185..12128461 126..402 100   Plus
3L 12128004..12128128 1..125 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:37 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12128185..12128461 126..402 100   Plus
3L 12128004..12128128 1..125 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:37 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12128185..12128461 126..402 100   Plus
3L 12128004..12128128 1..125 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:15 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12121104..12121228 1..125 100 -> Plus
arm_3L 12121285..12121561 126..402 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:06:22 Download gff for IP18013.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12121285..12121561 126..402 100   Plus
3L 12121104..12121228 1..125 100 -> Plus

IP18013.pep Sequence

Translation from 95 to 343

> IP18013.pep
MDRGTSSNQPILTTCEMYPRRRNTEFYRSPEPRVSCQNQRAEHPGQMLNV
TPDENREAVRRLPRIQPPNNLDSVYLRNGYFS*

IP18013.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19481-PA 81 GF19481-PA 11..81 15..82 156 49.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15559-PA 837 GG15559-PA 1..79 1..79 375 82.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34241-PA 82 CG34241-PA 1..82 1..82 444 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12893-PA 84 GL12893-PA 16..84 12..82 165 52.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22623-PA 84 GA22623-PA 16..84 12..82 161 52.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25327-PA 828 GM25327-PA 1..79 1..79 408 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14357-PA 82 GD14357-PA 1..82 1..82 404 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24472-PA 73 GJ24472-PA 5..73 12..82 147 46.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21883-PA 76 GE21883-PA 2..76 8..82 331 81.3 Plus

IP18013.hyp Sequence

Translation from 95 to 343

> IP18013.hyp
MDRGTSSNQPILTTCEMYPRRRNTEFYRSPEPRVSCQNQRAEHPGQMLNV
TPDENREAVRRLPRIQPPNNLDSVYLRNGYFS*

IP18013.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34241-PA 82 CG34241-PA 1..82 1..82 444 100 Plus