Clone IP18032 Report

Search the DGRC for IP18032

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:180
Well:32
Vector:pOT2
Protein status:IP18032.pep:
Sequenced Size:721

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34453 2008-04-29 Release 5.5 accounting
CG34453 2008-04-29 Picked prior to 5.5
CG34453 2008-08-15 Release 5.9 accounting
CG34453 2008-12-18 5.12 accounting

Clone Sequence Records

IP18032.complete Sequence

721 bp assembled on 2007-01-15

GenBank Submission: BT030202

> IP18032.complete
GAACCTGCTAAAGTGATTGGAAAGCTAAAGGAGCAAGTGCGCATGGAGCA
CAATTCGCGTCGTAGTTTTCCAAAAGCTTGGAGCGAAATTTCGGGCAAGC
AAACTAACAAGTTCTACCACCAATCTGAGATTAATTCTCAACTAAGTAAC
CAGCTAAAATTAAAAGACCTGTGCCCTTTTGTGCACAACAACCAAGGCGA
ATCGCGATTCGTATCTCCGGAGATGTACAAACCTTTACTGGCCGTCTGTC
GCTGTGGGCGAACTAAGGAAAGCATCCATATGGGAAAATGCTTACAAAGA
GCCTTGAGTCCAGATTACAAGCAAGAAATGGTACAGAATGGCACTGATGC
ATGGAGTGCAGAACCATTTAATGTGCCTTCCACTTCAAGCTCTACCATTG
GCTTCGCAGCTATTTCGAAAAACTACCAAAAGCTGGAGCGTTCTATGCAA
TATGTTTCTCCTGCGTTTTCCATGCCTGGCCCTCGAATTACAGCAGTCCC
TTACTATAATATTATTATTGGATAAGTCATCACGAATTTTAAAGTTTCTT
GTTGGTCATTTCCAACCCATATTTTTGATGAATCAAATCTGGGATTTCCC
TAGATTATTGCAAATATAAGCACATGATAATAAACTTAAAATTGATAGCG
GGCATCGTACAGAACTGGATTTTCCAGACGATTGACTGCTTTAGAAACCT
GTAAAAAAAAAAAAAAAAAAA

IP18032.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG34453-RB 745 CG34453-RB 44..745 1..702 3510 100 Plus
CG34453.a 751 CG34453.a 76..751 27..702 3380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 232435..232745 702..392 1555 100 Minus
chr3L 24539361 chr3L 232803..233029 391..165 1135 100 Minus
chr3L 24539361 chr3L 233080..233219 166..27 700 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 232479..232790 703..392 1560 100 Minus
3L 28110227 3L 232848..233074 391..165 1135 100 Minus
3L 28110227 3L 233125..233264 166..27 700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 232479..232790 703..392 1560 100 Minus
3L 28103327 3L 232848..233074 391..165 1135 100 Minus
3L 28103327 3L 233125..233264 166..27 700 100 Minus
Blast to na_te.dros performed 2019-03-16 04:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 4988..5066 580..501 127 68.7 Minus

IP18032.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:25:09 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 232435..232745 392..702 100 <- Minus
chr3L 232803..233027 167..391 100 <- Minus
chr3L 233080..233219 27..166 100 <- Minus
chr3L 233278..233303 1..26 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:04 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..528 1..525 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:09 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..528 1..525 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:29:02 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..528 1..525 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:22:18 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..528 1..525 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:38:50 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..528 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:41:00 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..705 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:09 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..705 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:29:02 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..705 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:22:18 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..705 1..702 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:38:50 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
CG34453-RB 4..705 1..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:25:09 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 232480..232790 392..702 100 <- Minus
3L 232848..233072 167..391 100 <- Minus
3L 233125..233264 27..166 100 <- Minus
3L 233323..233348 1..26 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:25:09 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 232480..232790 392..702 100 <- Minus
3L 232848..233072 167..391 100 <- Minus
3L 233125..233264 27..166 100 <- Minus
3L 233323..233348 1..26 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:25:09 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 232480..232790 392..702 100 <- Minus
3L 232848..233072 167..391 100 <- Minus
3L 233125..233264 27..166 100 <- Minus
3L 233323..233348 1..26 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:29:02 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 232480..232790 392..702 100 <- Minus
arm_3L 232848..233072 167..391 100 <- Minus
arm_3L 233125..233264 27..166 100 <- Minus
arm_3L 233323..233348 1..26 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:49 Download gff for IP18032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 232480..232790 392..702 100 <- Minus
3L 232848..233072 167..391 100 <- Minus
3L 233125..233264 27..166 100 <- Minus
3L 233323..233348 1..26 100   Minus

IP18032.pep Sequence

Translation from 0 to 524

> IP18032.pep
EPAKVIGKLKEQVRMEHNSRRSFPKAWSEISGKQTNKFYHQSEINSQLSN
QLKLKDLCPFVHNNQGESRFVSPEMYKPLLAVCRCGRTKESIHMGKCLQR
ALSPDYKQEMVQNGTDAWSAEPFNVPSTSSSTIGFAAISKNYQKLERSMQ
YVSPAFSMPGPRITAVPYYNIIIG*

IP18032.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25053-PA 288 GF25053-PA 1..125 15..133 401 58.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14676-PA 274 GG14676-PA 1..142 15..163 559 70 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21746-PA 156 GH21746-PA 2..156 13..174 414 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34453-PB 175 CG34453-PB 2..175 1..174 918 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17273-PA 147 GI17273-PA 1..147 15..174 368 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16102-PA 469 GL16102-PA 1..98 15..112 329 64.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28492-PA 313 GA28492-PA 1..98 15..112 325 64.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14292-PA 424 GM14292-PA 1..125 15..139 588 85.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13530-PA 426 GD13530-PA 1..125 15..139 585 85.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22801-PA 168 GJ22801-PA 2..168 1..174 436 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11275-PA 280 GK11275-PA 1..122 15..130 319 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21037-PA 433 GE21037-PA 1..119 15..133 551 85.7 Plus

IP18032.hyp Sequence

Translation from 0 to 524

> IP18032.hyp
EPAKVIGKLKEQVRMEHNSRRSFPKAWSEISGKQTNKFYHQSEINSQLSN
QLKLKDLCPFVHNNQGESRFVSPEMYKPLLAVCRCGRTKESIHMGKCLQR
ALSPDYKQEMVQNGTDAWSAEPFNVPSTSSSTIGFAAISKNYQKLERSMQ
YVSPAFSMPGPRITAVPYYNIIIG*

IP18032.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34453-PB 175 CG34453-PB 2..175 1..174 918 100 Plus