Clone IP18037 Report

Search the DGRC for IP18037

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:180
Well:37
Vector:pOT2
Associated Gene/TranscriptCG34264-RB
Protein status:IP18037.pep: gold
Sequenced Size:588

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34264 2008-04-29 Release 5.5 accounting
CG34264 2008-08-15 Release 5.9 accounting
CG34264 2008-12-18 5.12 accounting

Clone Sequence Records

IP18037.complete Sequence

588 bp assembled on 2007-01-15

GenBank Submission: BT030203

> IP18037.complete
CAACCTTATAGCTCCTCACAACGAGCATGAAAATTCAAATTGGTTTTCTA
GTTTTTTTATTACTGGACGGTTATATTAAAAGACCGTTTCTTCAACTCAT
CCAAATTATCCTGGTGCACGCTATATGGCGCGTTCCCAGTCGAAAATGAT
TCGGGCCGCCATGGTCGTGGACGACCCTAATATGGTGGCCTGGCTGCCAT
ACCTTAACTTTCTTCGCTTTCTGAAGCGAAACTTCTATCCCAGGACTGAT
TTGCGCCGCTTACTTCAGGTGGGACTCATCCGTTGGATCGCACTTAGCGA
TGCCCAGAAGAGGTTATTTGAGCCAGAACGAATCCTGGCGCGTGTGGCTC
GCAGGCAAAGGAATAAACGACGCCGCCGACTACTTCGCCGTGCTCGGCAT
GGCCAGAAAGGACGTGGTGCAGTGCGACGCCCCATCTACGACAGCCGTCC
TAAACCGCGACGCCGCAAACCGAAGTAGAGAGTGAGCAATGCATTTTGAA
ATCAAAACTACTATTCTTAGGTGGCTGTCAATGAAAGTATGCGTATCATA
TTCATATCTTCTTAAAAAAAAAAAAAAAAAAAAAAAAA

IP18037.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-RC 713 CG34264-RC 31..594 1..564 2820 100 Plus
CG34264-RB 678 CG34264-RB 79..598 1..520 2600 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 317037..317364 1..328 1640 100 Plus
chr3L 24539361 chr3L 317418..317652 329..563 1175 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 317084..317411 1..328 1640 100 Plus
3L 28110227 3L 317465..317700 329..564 1180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 317084..317411 1..328 1640 100 Plus
3L 28103327 3L 317465..317700 329..564 1180 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:29:38 has no hits.

IP18037.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:30:44 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 317037..317364 1..328 100 -> Plus
chr3L 317418..317652 329..563 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:09 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..354 125..478 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:48 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..354 125..478 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:24 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 1..354 125..478 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:31 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..354 125..478 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:20:19 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 1..354 125..478 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:37 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..563 1..563 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:48 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..563 1..563 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:24 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..563 1..563 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:31 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..563 1..563 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:20:19 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RC 1..563 1..563 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:44 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
3L 317084..317411 1..328 100 -> Plus
3L 317465..317699 329..563 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:44 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
3L 317084..317411 1..328 100 -> Plus
3L 317465..317699 329..563 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:30:44 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
3L 317084..317411 1..328 100 -> Plus
3L 317465..317699 329..563 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:24 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 317084..317411 1..328 100 -> Plus
arm_3L 317465..317699 329..563 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:34 Download gff for IP18037.complete
Subject Subject Range Query Range Percent Splice Strand
3L 317084..317411 1..328 100 -> Plus
3L 317465..317699 329..563 100   Plus

IP18037.pep Sequence

Translation from 124 to 477

> IP18037.pep
MARSQSKMIRAAMVVDDPNMVAWLPYLNFLRFLKRNFYPRTDLRRLLQVG
LIRWIALSDAQKRLFEPERILARVARRQRNKRRRRLLRRARHGQKGRGAV
RRPIYDSRPKPRRRKPK*

IP18037.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24748-PA 338 GF24748-PA 209..308 14..111 223 58 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14718-PA 117 GG14718-PA 1..112 1..112 391 84.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
ddbt-PC 117 CG34264-PC 1..117 1..117 601 100 Plus
ddbt-PB 117 CG34264-PB 1..117 1..117 601 100 Plus
ddbt-PD 114 CG34264-PD 1..62 1..62 318 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23451-PA 108 GI23451-PA 10..71 14..76 162 52.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16119-PA 145 GL16119-PA 31..94 8..72 153 56.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28389-PA 117 GA28389-PA 2..104 7..106 163 53.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14334-PA 108 GM14334-PA 1..55 8..62 264 94.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11012-PA 112 GD11012-PA 1..55 8..62 264 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23778-PA 113 GJ23778-PA 2..104 6..110 240 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21081-PA 117 GE21081-PA 1..106 1..106 344 86.8 Plus

IP18037.hyp Sequence

Translation from 124 to 477

> IP18037.hyp
MARSQSKMIRAAMVVDDPNMVAWLPYLNFLRFLKRNFYPRTDLRRLLQVG
LIRWIALSDAQKRLFEPERILARVARRQRNKRRRRLLRRARHGQKGRGAV
RRPIYDSRPKPRRRKPK*

IP18037.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-PC 117 CG34264-PC 1..117 1..117 601 100 Plus
CG34264-PB 117 CG34264-PB 1..117 1..117 601 100 Plus
CG34264-PD 114 CG34264-PD 1..62 1..62 318 100 Plus