BDGP Sequence Production Resources |
Search the DGRC for IP18037
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 180 |
Well: | 37 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34264-RB |
Protein status: | IP18037.pep: gold |
Sequenced Size: | 588 |
Gene | Date | Evidence |
---|---|---|
CG34264 | 2008-04-29 | Release 5.5 accounting |
CG34264 | 2008-08-15 | Release 5.9 accounting |
CG34264 | 2008-12-18 | 5.12 accounting |
588 bp assembled on 2007-01-15
GenBank Submission: BT030203
> IP18037.complete CAACCTTATAGCTCCTCACAACGAGCATGAAAATTCAAATTGGTTTTCTA GTTTTTTTATTACTGGACGGTTATATTAAAAGACCGTTTCTTCAACTCAT CCAAATTATCCTGGTGCACGCTATATGGCGCGTTCCCAGTCGAAAATGAT TCGGGCCGCCATGGTCGTGGACGACCCTAATATGGTGGCCTGGCTGCCAT ACCTTAACTTTCTTCGCTTTCTGAAGCGAAACTTCTATCCCAGGACTGAT TTGCGCCGCTTACTTCAGGTGGGACTCATCCGTTGGATCGCACTTAGCGA TGCCCAGAAGAGGTTATTTGAGCCAGAACGAATCCTGGCGCGTGTGGCTC GCAGGCAAAGGAATAAACGACGCCGCCGACTACTTCGCCGTGCTCGGCAT GGCCAGAAAGGACGTGGTGCAGTGCGACGCCCCATCTACGACAGCCGTCC TAAACCGCGACGCCGCAAACCGAAGTAGAGAGTGAGCAATGCATTTTGAA ATCAAAACTACTATTCTTAGGTGGCTGTCAATGAAAGTATGCGTATCATA TTCATATCTTCTTAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 317037..317364 | 1..328 | 100 | -> | Plus |
chr3L | 317418..317652 | 329..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..354 | 125..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..354 | 125..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RB | 1..354 | 125..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..354 | 125..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RB | 1..354 | 125..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..563 | 1..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..563 | 1..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..563 | 1..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..563 | 1..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34264-RC | 1..563 | 1..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 317084..317411 | 1..328 | 100 | -> | Plus |
3L | 317465..317699 | 329..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 317084..317411 | 1..328 | 100 | -> | Plus |
3L | 317465..317699 | 329..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 317084..317411 | 1..328 | 100 | -> | Plus |
3L | 317465..317699 | 329..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 317084..317411 | 1..328 | 100 | -> | Plus |
arm_3L | 317465..317699 | 329..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 317084..317411 | 1..328 | 100 | -> | Plus |
3L | 317465..317699 | 329..563 | 100 | Plus |
Translation from 124 to 477
> IP18037.pep MARSQSKMIRAAMVVDDPNMVAWLPYLNFLRFLKRNFYPRTDLRRLLQVG LIRWIALSDAQKRLFEPERILARVARRQRNKRRRRLLRRARHGQKGRGAV RRPIYDSRPKPRRRKPK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24748-PA | 338 | GF24748-PA | 209..308 | 14..111 | 223 | 58 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14718-PA | 117 | GG14718-PA | 1..112 | 1..112 | 391 | 84.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ddbt-PC | 117 | CG34264-PC | 1..117 | 1..117 | 601 | 100 | Plus |
ddbt-PB | 117 | CG34264-PB | 1..117 | 1..117 | 601 | 100 | Plus |
ddbt-PD | 114 | CG34264-PD | 1..62 | 1..62 | 318 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23451-PA | 108 | GI23451-PA | 10..71 | 14..76 | 162 | 52.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16119-PA | 145 | GL16119-PA | 31..94 | 8..72 | 153 | 56.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28389-PA | 117 | GA28389-PA | 2..104 | 7..106 | 163 | 53.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14334-PA | 108 | GM14334-PA | 1..55 | 8..62 | 264 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11012-PA | 112 | GD11012-PA | 1..55 | 8..62 | 264 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23778-PA | 113 | GJ23778-PA | 2..104 | 6..110 | 240 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21081-PA | 117 | GE21081-PA | 1..106 | 1..106 | 344 | 86.8 | Plus |
Translation from 124 to 477
> IP18037.hyp MARSQSKMIRAAMVVDDPNMVAWLPYLNFLRFLKRNFYPRTDLRRLLQVG LIRWIALSDAQKRLFEPERILARVARRQRNKRRRRLLRRARHGQKGRGAV RRPIYDSRPKPRRRKPK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34264-PC | 117 | CG34264-PC | 1..117 | 1..117 | 601 | 100 | Plus |
CG34264-PB | 117 | CG34264-PB | 1..117 | 1..117 | 601 | 100 | Plus |
CG34264-PD | 114 | CG34264-PD | 1..62 | 1..62 | 318 | 100 | Plus |