Clone IP18111 Report

Search the DGRC for IP18111

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:181
Well:11
Vector:pOT2
Associated Gene/TranscriptCG34240-RA
Protein status:IP18111.pep:
Sequenced Size:814

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34240 2008-04-29 Release 5.5 accounting
CG34240 2008-08-15 Release 5.9 accounting
CG34240 2008-12-18 5.12 accounting

Clone Sequence Records

IP18111.complete Sequence

814 bp assembled on 2007-01-15

GenBank Submission: BT030214

> IP18111.complete
ATACTTTCCACTACAAAAACATGCCACACGATCTAACATGGTGCAAGCAG
CAGCGGCAGCAGCAGATTGTATCACTAGAATCCAAATCTAGTGTCAGATA
CAATCGCCGAATCGAATCGAATCGAACAACGATCATTTTGAGAACGGATC
TAACTCGCGTAGTATCCACAAAGAAAATAAAAAAAACGATTTTCCAATGC
AACGACAACTAGAATGAAATGCTTAGTAACGACAGCCAACCCGAAGCCAA
ATGTGGGGCTATCATTTGCCAATTGTGCTGCGCCCAGCCAACAATATGAC
CATCACGAGCGGAGGCAACAGCTACAGTCCTCGAAACTCCGTGGAAAACG
ACGCCTGGACGCTTGGTGAATCCTCCGAGTATGGTGAATATCCCGATGAC
TACGATGAAAACGATGAGGAGCACGGCGATGAGGATATTGACTACGTTGG
CCAGGAATCCGACGATGTTTTCGAAACGGAATCTGGAGAGGCTGCAGTTC
AGGGCGCACAGTAGACAACTAGGCAACTAAACAAAACACAAACCAGCAAC
AGTGATAAATAATTCGATATATACATAACTCTATATATATATATATGTAT
AACATATTGTATTTCTTAGCGATTGATGAAGTATATCGCTTAGCCGACAT
GATTTTCCCTTGGCTTGTTCGAACTATTTAAATGAAGTTTTGTATTTTGA
AAACAGAAGATCATCGAATAATGCAATAAACTGAACACGCTAAGTGAAAA
TGTTACTTCAGCTTTGTCCACATGATGTAGTGGAATATGTTTTTTTAAAA
AAAAAAAAAAAAAA

IP18111.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34240.a 1757 CG34240.a 1..797 1..797 3985 100 Plus
CG34240-RA 796 CG34240-RA 1..796 1..796 3980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11219977..11220499 274..796 2615 100 Plus
chr3L 24539361 chr3L 11218680..11218952 1..273 1365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11229113..11229636 274..797 2620 100 Plus
3L 28110227 3L 11227816..11228088 1..273 1365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11222213..11222736 274..797 2620 100 Plus
3L 28103327 3L 11220916..11221188 1..273 1365 100 Plus
Blast to na_te.dros performed 2019-03-16 03:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Cr1a 4470 Cr1a DMCR1A 4470bp 177..247 572..500 125 67.1 Minus

IP18111.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:56:02 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11218680..11218952 1..273 100 -> Plus
chr3L 11219977..11220499 274..796 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:27 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG34240-RA 1..219 296..514 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:36 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG42671-RD 3657..3906 265..514 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:28 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG42671-RF 3657..3906 265..514 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:21:45 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG34240-RA 1..219 296..514 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:20:09 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG42671-RD 3657..3906 265..514 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:40:33 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG34240-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:36 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG42671-RH 4084..4879 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:28 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG42671-RG 4122..4917 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:21:45 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG34240-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:20:09 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
CG42671-RG 4122..4917 1..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:02 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11227816..11228088 1..273 100 -> Plus
3L 11229113..11229635 274..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:02 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11227816..11228088 1..273 100 -> Plus
3L 11229113..11229635 274..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:02 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11227816..11228088 1..273 100 -> Plus
3L 11229113..11229635 274..796 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:28 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11220916..11221188 1..273 100 -> Plus
arm_3L 11222213..11222735 274..796 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:26 Download gff for IP18111.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11220916..11221188 1..273 100 -> Plus
3L 11222213..11222735 274..796 100   Plus

IP18111.pep Sequence

Translation from 250 to 513

> IP18111.pep
MWGYHLPIVLRPANNMTITSGGNSYSPRNSVENDAWTLGESSEYGEYPDD
YDENDEEHGDEDIDYVGQESDDVFETESGEAAVQGAQ*

IP18111.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15493-PA 76 GG15493-PA 1..76 16..87 337 93.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42671-PD 1301 CG42671-PD 1223..1301 9..87 423 100 Plus
CG42671-PF 1301 CG42671-PF 1223..1301 9..87 423 100 Plus
CG42671-PL 1302 CG42671-PL 1224..1302 9..87 423 100 Plus
CG42671-PK 1302 CG42671-PK 1224..1302 9..87 423 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22774-PA 1330 GL22774-PA 1247..1328 9..86 263 72 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25264-PA 72 GM25264-PA 1..72 16..87 353 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14298-PA 72 GD14298-PA 1..72 16..87 359 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21803-PA 72 GE21803-PA 1..72 16..87 343 94.4 Plus

IP18111.hyp Sequence

Translation from 250 to 513

> IP18111.hyp
MWGYHLPIVLRPANNMTITSGGNSYSPRNSVENDAWTLGESSEYGEYPDD
YDENDEEHGDEDIDYVGQESDDVFETESGEAAVQGAQ*

IP18111.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42671-PD 1301 CG42671-PD 1223..1301 9..87 423 100 Plus
CG42671-PF 1301 CG42671-PF 1223..1301 9..87 423 100 Plus
CG42671-PL 1302 CG42671-PL 1224..1302 9..87 423 100 Plus
CG42671-PK 1302 CG42671-PK 1224..1302 9..87 423 100 Plus