IP18111.complete Sequence
814 bp assembled on 2007-01-15
GenBank Submission: BT030214
> IP18111.complete
ATACTTTCCACTACAAAAACATGCCACACGATCTAACATGGTGCAAGCAG
CAGCGGCAGCAGCAGATTGTATCACTAGAATCCAAATCTAGTGTCAGATA
CAATCGCCGAATCGAATCGAATCGAACAACGATCATTTTGAGAACGGATC
TAACTCGCGTAGTATCCACAAAGAAAATAAAAAAAACGATTTTCCAATGC
AACGACAACTAGAATGAAATGCTTAGTAACGACAGCCAACCCGAAGCCAA
ATGTGGGGCTATCATTTGCCAATTGTGCTGCGCCCAGCCAACAATATGAC
CATCACGAGCGGAGGCAACAGCTACAGTCCTCGAAACTCCGTGGAAAACG
ACGCCTGGACGCTTGGTGAATCCTCCGAGTATGGTGAATATCCCGATGAC
TACGATGAAAACGATGAGGAGCACGGCGATGAGGATATTGACTACGTTGG
CCAGGAATCCGACGATGTTTTCGAAACGGAATCTGGAGAGGCTGCAGTTC
AGGGCGCACAGTAGACAACTAGGCAACTAAACAAAACACAAACCAGCAAC
AGTGATAAATAATTCGATATATACATAACTCTATATATATATATATGTAT
AACATATTGTATTTCTTAGCGATTGATGAAGTATATCGCTTAGCCGACAT
GATTTTCCCTTGGCTTGTTCGAACTATTTAAATGAAGTTTTGTATTTTGA
AAACAGAAGATCATCGAATAATGCAATAAACTGAACACGCTAAGTGAAAA
TGTTACTTCAGCTTTGTCCACATGATGTAGTGGAATATGTTTTTTTAAAA
AAAAAAAAAAAAAA
IP18111.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:08:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34240.a | 1757 | CG34240.a | 1..797 | 1..797 | 3985 | 100 | Plus |
CG34240-RA | 796 | CG34240-RA | 1..796 | 1..796 | 3980 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:55:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 11219977..11220499 | 274..796 | 2615 | 100 | Plus |
chr3L | 24539361 | chr3L | 11218680..11218952 | 1..273 | 1365 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:55:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 11229113..11229636 | 274..797 | 2620 | 100 | Plus |
3L | 28110227 | 3L | 11227816..11228088 | 1..273 | 1365 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 11222213..11222736 | 274..797 | 2620 | 100 | Plus |
3L | 28103327 | 3L | 11220916..11221188 | 1..273 | 1365 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 03:55:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cr1a | 4470 | Cr1a DMCR1A 4470bp | 177..247 | 572..500 | 125 | 67.1 | Minus |
IP18111.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:56:02 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 11218680..11218952 | 1..273 | 100 | -> | Plus |
chr3L | 11219977..11220499 | 274..796 | 92 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:27 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34240-RA | 1..219 | 296..514 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:36 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42671-RD | 3657..3906 | 265..514 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:28 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42671-RF | 3657..3906 | 265..514 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:21:45 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34240-RA | 1..219 | 296..514 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:20:09 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42671-RD | 3657..3906 | 265..514 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:40:33 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34240-RA | 1..796 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:36 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42671-RH | 4084..4879 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:28 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42671-RG | 4122..4917 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:21:45 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34240-RA | 1..796 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:20:09 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42671-RG | 4122..4917 | 1..796 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:02 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11227816..11228088 | 1..273 | 100 | -> | Plus |
3L | 11229113..11229635 | 274..796 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:02 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11227816..11228088 | 1..273 | 100 | -> | Plus |
3L | 11229113..11229635 | 274..796 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:56:02 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11227816..11228088 | 1..273 | 100 | -> | Plus |
3L | 11229113..11229635 | 274..796 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:28 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 11220916..11221188 | 1..273 | 100 | -> | Plus |
arm_3L | 11222213..11222735 | 274..796 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:26 Download gff for
IP18111.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11220916..11221188 | 1..273 | 100 | -> | Plus |
3L | 11222213..11222735 | 274..796 | 100 | | Plus |
IP18111.pep Sequence
Translation from 250 to 513
> IP18111.pep
MWGYHLPIVLRPANNMTITSGGNSYSPRNSVENDAWTLGESSEYGEYPDD
YDENDEEHGDEDIDYVGQESDDVFETESGEAAVQGAQ*
IP18111.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:48:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15493-PA | 76 | GG15493-PA | 1..76 | 16..87 | 337 | 93.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42671-PD | 1301 | CG42671-PD | 1223..1301 | 9..87 | 423 | 100 | Plus |
CG42671-PF | 1301 | CG42671-PF | 1223..1301 | 9..87 | 423 | 100 | Plus |
CG42671-PL | 1302 | CG42671-PL | 1224..1302 | 9..87 | 423 | 100 | Plus |
CG42671-PK | 1302 | CG42671-PK | 1224..1302 | 9..87 | 423 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:48:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL22774-PA | 1330 | GL22774-PA | 1247..1328 | 9..86 | 263 | 72 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:48:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25264-PA | 72 | GM25264-PA | 1..72 | 16..87 | 353 | 98.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:48:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14298-PA | 72 | GD14298-PA | 1..72 | 16..87 | 359 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:48:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21803-PA | 72 | GE21803-PA | 1..72 | 16..87 | 343 | 94.4 | Plus |
IP18111.hyp Sequence
Translation from 250 to 513
> IP18111.hyp
MWGYHLPIVLRPANNMTITSGGNSYSPRNSVENDAWTLGESSEYGEYPDD
YDENDEEHGDEDIDYVGQESDDVFETESGEAAVQGAQ*
IP18111.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:52:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42671-PD | 1301 | CG42671-PD | 1223..1301 | 9..87 | 423 | 100 | Plus |
CG42671-PF | 1301 | CG42671-PF | 1223..1301 | 9..87 | 423 | 100 | Plus |
CG42671-PL | 1302 | CG42671-PL | 1224..1302 | 9..87 | 423 | 100 | Plus |
CG42671-PK | 1302 | CG42671-PK | 1224..1302 | 9..87 | 423 | 100 | Plus |