Clone IP18112 Report

Search the DGRC for IP18112

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:181
Well:12
Vector:pOT2
Associated Gene/TranscriptCG42397-RA
Protein status:IP18112.pep: gold
Sequenced Size:637

Clone Sequence Records

IP18112.complete Sequence

637 bp assembled on 2007-01-15

GenBank Submission: BT030215

> IP18112.complete
AAAACATGAAAGGTTTTCAGATAATCGGATTACTTGGATTGTTTGCACTC
CTTGTAAGTGGATCGACCTCGTCTGGAGAAGATACCAACATCAAACTAAC
AACAGACGAATCTACTACTGTGGAGGATACCACGGAGGTTTTAGTCACAA
CACTACCACCTCCAGTCCTGTGTGCTGATGAAGATCTGTTTCTCCCAGCA
CCCGACTGCAGAGAGTATTATCAATGCCTGTACGGTGAGGGAATTTTAAA
GATATGTCCAGACGGCCTCTATTGGGATCGGGAGCTGAATGTTTGCGCCT
GGGACTCACAGCATTGTGCTGATGACAAGAACGAGACCACCACACCATCG
ACCTTGAATTGCGCATCCGGGTTACCATTTTTGCCCTATATACCGGACTG
CACTAAGTTTATCCAGTGCGTCTACAATATTGGCTTTAAACTAAGCTGCC
CGAGTGGTTTGTATTGGAACCAACCTCTTCAATCGTGTGACTATACCTGC
GATAATGCGATTGAGTTCTCTGGCGCACACCAAGTGCAATAACCGCAAAT
TTAAGAGGTAGTATTTTGTAACACCCAAAAATGTACATTAATACCAAGCA
AAATAAAGAAATAGCAATACAAAAAAAAAAAAAAAAA

IP18112.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42397-RA 800 CG42397-RA 124..745 1..622 3110 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11963939..11964549 620..10 3025 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11973083..11973695 622..10 3065 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11966183..11966795 622..10 3065 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:36:03 has no hits.

IP18112.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:37:02 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11963939..11964549 10..620 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:38 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
CG42397-RA 1..537 6..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:24 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
CG42397-RA 1..537 6..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:21:46 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:06:47 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
CG42397-RA 1..537 6..542 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:38 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
CG42397-RA 32..651 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:24 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
CG42397-RA 32..651 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:21:46 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:06:47 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
CG42397-RA 32..651 1..620 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:02 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11973085..11973695 10..620 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:02 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11973085..11973695 10..620 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:02 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11973085..11973695 10..620 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:24 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11966185..11966795 10..620 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:27 Download gff for IP18112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11966185..11966795 10..620 100   Minus

IP18112.pep Sequence

Translation from 2 to 541

> IP18112.pep
NMKGFQIIGLLGLFALLVSGSTSSGEDTNIKLTTDESTTVEDTTEVLVTT
LPPPVLCADEDLFLPAPDCREYYQCLYGEGILKICPDGLYWDRELNVCAW
DSQHCADDKNETTTPSTLNCASGLPFLPYIPDCTKFIQCVYNIGFKLSCP
SGLYWNQPLQSCDYTCDNAIEFSGAHQVQ*

IP18112.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24492-PA 182 GF24492-PA 63..182 53..170 437 65 Plus
Dana\GF24494-PA 1254 GF24494-PA 1085..1179 63..156 155 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13864-PA 178 GG13864-PA 1..178 2..179 810 86 Plus
Dere\GG13865-PA 811 GG13865-PA 707..804 63..163 214 39.2 Plus
Dere\GG13865-PA 811 GG13865-PA 634..759 53..178 200 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17129-PA 592 GH17129-PA 89..229 11..163 143 29.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42397-PA 178 CG42397-PA 1..178 2..179 984 100 Plus
Muc68E-PA 1799 CG33265-PA 1580..1734 9..165 246 34.8 Plus
Muc68E-PA 1799 CG33265-PA 1684..1792 52..163 209 35.4 Plus
CG17826-PA 751 CG17826-PA 27..128 55..166 180 36.3 Plus
Cht10-PA 2286 CG18140-PA 795..912 53..164 147 26.3 Plus
Cht10-PC 2286 CG18140-PC 795..912 53..164 147 26.3 Plus
Cht10-PB 2286 CG18140-PB 795..912 53..164 147 26.3 Plus
CG43294-PB 124 CG43294-PB 13..123 68..166 138 32.5 Plus
CG43294-PC 143 CG43294-PC 32..142 68..166 138 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11735-PA 552 GI11735-PA 157..244 68..163 148 35.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25064-PA 665 GL25064-PA 1..154 2..138 318 46.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25359-PA 2487 GA25359-PA 889..1046 18..164 154 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24687-PA 689 GM24687-PA 1..176 2..177 904 94.9 Plus
Dsec\GM24687-PA 689 GM24687-PA 512..624 53..165 208 36.8 Plus
Dsec\GM24687-PA 689 GM24687-PA 585..682 63..163 194 36.3 Plus
Dsec\GM25311-PA 590 GM25311-PA 19..123 47..162 143 31.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12757-PA 519 GD12757-PA 1..150 2..151 762 94.7 Plus
Dsim\GD12757-PA 519 GD12757-PA 415..514 63..165 192 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13907-PA 166 GJ13907-PA 9..164 28..166 362 49 Plus
Dvir\GJ11411-PA 1579 GJ11411-PA 495..623 39..168 143 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17254-PA 2562 GK17254-PA 76..126 52..102 216 70.6 Plus
Dwil\GK17254-PA 2562 GK17254-PA 2467..2548 68..156 155 38.9 Plus
Dwil\GK17254-PA 2562 GK17254-PA 2406..2501 68..166 149 38 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20156-PA 1297 GE20156-PA 1..176 2..177 807 83.5 Plus
Dyak\GE20156-PA 1297 GE20156-PA 1193..1290 63..163 200 38.2 Plus
Dyak\GE20156-PA 1297 GE20156-PA 1120..1231 53..164 195 36.3 Plus

IP18112.hyp Sequence

Translation from 11 to 541

> IP18112.hyp
GFQIIGLLGLFALLVSGSTSSGEDTNIKLTTDESTTVEDTTEVLVTTLPP
PVLCADEDLFLPAPDCREYYQCLYGEGILKICPDGLYWDRELNVCAWDSQ
HCADDKNETTTPSTLNCASGLPFLPYIPDCTKFIQCVYNIGFKLSCPSGL
YWNQPLQSCDYTCDNAIEFSGAHQVQ*

IP18112.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42397-PA 178 CG42397-PA 3..178 1..176 974 100 Plus
Muc68E-PA 1799 CG33265-PA 1580..1734 6..162 246 34.8 Plus
Muc68E-PA 1799 CG33265-PA 1684..1792 49..160 209 35.4 Plus
CG17826-PA 751 CG17826-PA 27..128 52..163 180 36.3 Plus
CG43294-PB 124 CG43294-PB 13..123 65..163 138 32.5 Plus
CG43294-PA 124 CG43294-PA 13..123 65..163 138 32.5 Plus