IP18112.complete Sequence
637 bp assembled on 2007-01-15
GenBank Submission: BT030215
> IP18112.complete
AAAACATGAAAGGTTTTCAGATAATCGGATTACTTGGATTGTTTGCACTC
CTTGTAAGTGGATCGACCTCGTCTGGAGAAGATACCAACATCAAACTAAC
AACAGACGAATCTACTACTGTGGAGGATACCACGGAGGTTTTAGTCACAA
CACTACCACCTCCAGTCCTGTGTGCTGATGAAGATCTGTTTCTCCCAGCA
CCCGACTGCAGAGAGTATTATCAATGCCTGTACGGTGAGGGAATTTTAAA
GATATGTCCAGACGGCCTCTATTGGGATCGGGAGCTGAATGTTTGCGCCT
GGGACTCACAGCATTGTGCTGATGACAAGAACGAGACCACCACACCATCG
ACCTTGAATTGCGCATCCGGGTTACCATTTTTGCCCTATATACCGGACTG
CACTAAGTTTATCCAGTGCGTCTACAATATTGGCTTTAAACTAAGCTGCC
CGAGTGGTTTGTATTGGAACCAACCTCTTCAATCGTGTGACTATACCTGC
GATAATGCGATTGAGTTCTCTGGCGCACACCAAGTGCAATAACCGCAAAT
TTAAGAGGTAGTATTTTGTAACACCCAAAAATGTACATTAATACCAAGCA
AAATAAAGAAATAGCAATACAAAAAAAAAAAAAAAAA
IP18112.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:08:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42397-RA | 800 | CG42397-RA | 124..745 | 1..622 | 3110 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:36:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 11963939..11964549 | 620..10 | 3025 | 99.7 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:34:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:36:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 11973083..11973695 | 622..10 | 3065 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 11966183..11966795 | 622..10 | 3065 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 00:36:03 has no hits.
IP18112.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:37:02 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 11963939..11964549 | 10..620 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:38 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42397-RA | 1..537 | 6..542 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:24 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42397-RA | 1..537 | 6..542 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:21:46 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:06:47 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42397-RA | 1..537 | 6..542 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:38 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42397-RA | 32..651 | 1..620 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:24 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42397-RA | 32..651 | 1..620 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:21:46 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:06:47 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42397-RA | 32..651 | 1..620 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:02 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11973085..11973695 | 10..620 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:02 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11973085..11973695 | 10..620 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:37:02 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11973085..11973695 | 10..620 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:24 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 11966185..11966795 | 10..620 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:27 Download gff for
IP18112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11966185..11966795 | 10..620 | 100 | | Minus |
IP18112.pep Sequence
Translation from 2 to 541
> IP18112.pep
NMKGFQIIGLLGLFALLVSGSTSSGEDTNIKLTTDESTTVEDTTEVLVTT
LPPPVLCADEDLFLPAPDCREYYQCLYGEGILKICPDGLYWDRELNVCAW
DSQHCADDKNETTTPSTLNCASGLPFLPYIPDCTKFIQCVYNIGFKLSCP
SGLYWNQPLQSCDYTCDNAIEFSGAHQVQ*
IP18112.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:48:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24492-PA | 182 | GF24492-PA | 63..182 | 53..170 | 437 | 65 | Plus |
Dana\GF24494-PA | 1254 | GF24494-PA | 1085..1179 | 63..156 | 155 | 40 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:48:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13864-PA | 178 | GG13864-PA | 1..178 | 2..179 | 810 | 86 | Plus |
Dere\GG13865-PA | 811 | GG13865-PA | 707..804 | 63..163 | 214 | 39.2 | Plus |
Dere\GG13865-PA | 811 | GG13865-PA | 634..759 | 53..178 | 200 | 33.1 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:48:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH17129-PA | 592 | GH17129-PA | 89..229 | 11..163 | 143 | 29.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42397-PA | 178 | CG42397-PA | 1..178 | 2..179 | 984 | 100 | Plus |
Muc68E-PA | 1799 | CG33265-PA | 1580..1734 | 9..165 | 246 | 34.8 | Plus |
Muc68E-PA | 1799 | CG33265-PA | 1684..1792 | 52..163 | 209 | 35.4 | Plus |
CG17826-PA | 751 | CG17826-PA | 27..128 | 55..166 | 180 | 36.3 | Plus |
Cht10-PA | 2286 | CG18140-PA | 795..912 | 53..164 | 147 | 26.3 | Plus |
Cht10-PC | 2286 | CG18140-PC | 795..912 | 53..164 | 147 | 26.3 | Plus |
Cht10-PB | 2286 | CG18140-PB | 795..912 | 53..164 | 147 | 26.3 | Plus |
CG43294-PB | 124 | CG43294-PB | 13..123 | 68..166 | 138 | 32.5 | Plus |
CG43294-PC | 143 | CG43294-PC | 32..142 | 68..166 | 138 | 32.5 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:48:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI11735-PA | 552 | GI11735-PA | 157..244 | 68..163 | 148 | 35.4 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:48:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25064-PA | 665 | GL25064-PA | 1..154 | 2..138 | 318 | 46.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:48:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25359-PA | 2487 | GA25359-PA | 889..1046 | 18..164 | 154 | 27.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:48:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24687-PA | 689 | GM24687-PA | 1..176 | 2..177 | 904 | 94.9 | Plus |
Dsec\GM24687-PA | 689 | GM24687-PA | 512..624 | 53..165 | 208 | 36.8 | Plus |
Dsec\GM24687-PA | 689 | GM24687-PA | 585..682 | 63..163 | 194 | 36.3 | Plus |
Dsec\GM25311-PA | 590 | GM25311-PA | 19..123 | 47..162 | 143 | 31.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:48:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12757-PA | 519 | GD12757-PA | 1..150 | 2..151 | 762 | 94.7 | Plus |
Dsim\GD12757-PA | 519 | GD12757-PA | 415..514 | 63..165 | 192 | 35.6 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:48:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ13907-PA | 166 | GJ13907-PA | 9..164 | 28..166 | 362 | 49 | Plus |
Dvir\GJ11411-PA | 1579 | GJ11411-PA | 495..623 | 39..168 | 143 | 32.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:48:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK17254-PA | 2562 | GK17254-PA | 76..126 | 52..102 | 216 | 70.6 | Plus |
Dwil\GK17254-PA | 2562 | GK17254-PA | 2467..2548 | 68..156 | 155 | 38.9 | Plus |
Dwil\GK17254-PA | 2562 | GK17254-PA | 2406..2501 | 68..166 | 149 | 38 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:48:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20156-PA | 1297 | GE20156-PA | 1..176 | 2..177 | 807 | 83.5 | Plus |
Dyak\GE20156-PA | 1297 | GE20156-PA | 1193..1290 | 63..163 | 200 | 38.2 | Plus |
Dyak\GE20156-PA | 1297 | GE20156-PA | 1120..1231 | 53..164 | 195 | 36.3 | Plus |
IP18112.hyp Sequence
Translation from 11 to 541
> IP18112.hyp
GFQIIGLLGLFALLVSGSTSSGEDTNIKLTTDESTTVEDTTEVLVTTLPP
PVLCADEDLFLPAPDCREYYQCLYGEGILKICPDGLYWDRELNVCAWDSQ
HCADDKNETTTPSTLNCASGLPFLPYIPDCTKFIQCVYNIGFKLSCPSGL
YWNQPLQSCDYTCDNAIEFSGAHQVQ*
IP18112.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:52:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42397-PA | 178 | CG42397-PA | 3..178 | 1..176 | 974 | 100 | Plus |
Muc68E-PA | 1799 | CG33265-PA | 1580..1734 | 6..162 | 246 | 34.8 | Plus |
Muc68E-PA | 1799 | CG33265-PA | 1684..1792 | 49..160 | 209 | 35.4 | Plus |
CG17826-PA | 751 | CG17826-PA | 27..128 | 52..163 | 180 | 36.3 | Plus |
CG43294-PB | 124 | CG43294-PB | 13..123 | 65..163 | 138 | 32.5 | Plus |
CG43294-PA | 124 | CG43294-PA | 13..123 | 65..163 | 138 | 32.5 | Plus |