Clone IP18157 Report

Search the DGRC for IP18157

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:181
Well:57
Vector:pOT2
Associated Gene/TranscriptCG34274-RA
Protein status:IP18157.pep: gold
Sequenced Size:859

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34274 2008-04-29 Release 5.5 accounting
CG34274 2008-08-15 Release 5.9 accounting
CG34274 2008-12-18 5.12 accounting

Clone Sequence Records

IP18157.complete Sequence

859 bp assembled on 2007-01-15

GenBank Submission: BT030221

> IP18157.complete
AAACACAATAAAGTAAAAAAAAAATATATATAAAACTTAGAATGCCCTTA
ACCACCAATACAGTGGACAAAAAAAATGAACACGAAAAACCATTTGGCTT
AGAAATACCCAAACCAGAGCTATTTATATATCAGCACCCCGCAGCCGATG
AGTCCTTTCTTAAAGAACAACCTACCAAGGTCGAAGATGTGATCGAGTAC
CTGGATGTGCTTGAAAACGCCAACAAGACCGATTCGTCAAAAAAAAGACA
AAAATCTACGATTACCATGGATGACATAAAATGTATTGTGACACGGCGAA
GTGCTGTAAGCACGACAACATTTCGTCGAGGCAAAGCAAAAAGAGCCTTA
ATTAACACGAATCAATTCACGTTTATGCGTCAGATTGATTCGGAACCCGA
TGATCGTGTTTTGGCCAGAGAACAGCGTGAAGATGTGGCCGAAACATTTC
GTCGGATGGGAAATTACGAGTATCGTAAACTAAACTTCAGTTTAGCCAAA
GACTACTATTCAAAGGGTATACAATACATAAAAGACTCGCCTGTCCTATA
CGTAAATCGAGCCCTTTGCTTTATCAAGTTACGCGAATTTAAGCTAGGTA
TCATAGATTGTGATTATGTGTTGGCCAAAATTGACGAACATTATCTGCGT
GCTTGGCTTTATAGGGCAGCTGCCTATAAGCGTCTGAATGATGAGCCAAA
CTTTGAATATAGTGTTGATCGCGCCAGACGATTTAACAGATCGGATGCTG
ACTTTATAGATGAATTCCTGGACAAAATGAGATCGCTTCTCTAAAAAATT
ATAAGTAAATTAAGCAATAAACGAATGAACAAAACCTTGAAAAAAAAAAA
AAAAAAAAA

IP18157.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34274-RA 869 CG34274-RA 27..867 1..841 4205 100 Plus
CG34274.b 838 CG34274.b 20..598 1..579 2895 100 Plus
CG34274.a 849 CG34274.a 27..603 1..577 2885 100 Plus
CG34274.a 849 CG34274.a 604..849 594..839 1230 100 Plus
CG34274.b 838 CG34274.b 597..838 598..839 1210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11556637..11556983 233..579 1705 99.4 Plus
chr3R 27901430 chr3R 11557034..11557295 578..839 1280 99.2 Plus
chr3R 27901430 chr3R 11556347..11556578 1..232 1160 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15732036..15732382 233..579 1735 100 Plus
3R 32079331 3R 15732433..15732696 578..841 1320 100 Plus
3R 32079331 3R 15731746..15731977 1..232 1160 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15472867..15473213 233..579 1735 100 Plus
3R 31820162 3R 15473264..15473527 578..841 1320 100 Plus
3R 31820162 3R 15472577..15472808 1..232 1160 100 Plus
Blast to na_te.dros performed 2019-03-16 16:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6750..6792 1..43 125 76.7 Plus

IP18157.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:27:07 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11557034..11557295 578..839 99   Plus
chr3R 11556637..11556981 233..577 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:35 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..753 42..794 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:20 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..753 42..794 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:17 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..753 42..794 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:21:25 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..753 42..794 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:28:04 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..753 42..794 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:40:16 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..753 42..794 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:19 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..839 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:17 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..839 1..839 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:21:25 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..753 42..794 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:28:04 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
CG34274-RA 1..839 1..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:07 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15731746..15731977 1..232 100 -> Plus
3R 15732036..15732380 233..577 100 -> Plus
3R 15732433..15732694 578..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:07 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15731746..15731977 1..232 100 -> Plus
3R 15732036..15732380 233..577 100 -> Plus
3R 15732433..15732694 578..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:07 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15731746..15731977 1..232 100 -> Plus
3R 15732036..15732380 233..577 100 -> Plus
3R 15732433..15732694 578..839 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:17 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11557468..11557699 1..232 100 -> Plus
arm_3R 11557758..11558102 233..577 100 -> Plus
arm_3R 11558155..11558416 578..839 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:14 Download gff for IP18157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15472577..15472808 1..232 100 -> Plus
3R 15472867..15473211 233..577 100 -> Plus
3R 15473264..15473525 578..839 100   Plus

IP18157.pep Sequence

Translation from 41 to 793

> IP18157.pep
MPLTTNTVDKKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVEDV
IEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAK
RALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFS
LAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEH
YLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDADFIDEFLDKMRSLL
*

IP18157.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18534-PA 242 GF18534-PA 12..242 23..250 707 58.4 Plus
Dana\GF17796-PA 237 GF17796-PA 1..235 27..248 474 43.7 Plus
Dana\GF16481-PA 225 GF16481-PA 3..223 35..248 399 40.8 Plus
Dana\GF16241-PA 247 GF16241-PA 69..244 73..248 278 34.1 Plus
Dana\GF20636-PA 489 GF20636-PA 316..417 140..242 145 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16942-PA 250 GG16942-PA 1..250 1..250 1126 82.8 Plus
Dere\GG10246-PA 233 GG10246-PA 1..233 27..247 473 43.6 Plus
Dere\GG20410-PA 225 GG20410-PA 3..223 35..248 443 44.6 Plus
Dere\GG11320-PA 244 GG11320-PA 101..242 107..248 299 41.5 Plus
Dere\GG24711-PA 490 GG24711-PA 310..418 133..242 157 28.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18212-PA 234 GH18212-PA 7..232 31..248 566 51.8 Plus
Dgri\GH19482-PA 216 GH19482-PA 1..216 27..250 425 39.3 Plus
Dgri\GH19113-PA 219 GH19113-PA 76..215 107..246 295 42.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34274-PA 250 CG34274-PA 1..250 1..250 1296 100 Plus
CG34297-PA 233 CG34297-PA 1..233 27..247 486 44.4 Plus
CG31294-PA 225 CG31294-PA 3..223 35..248 449 44.6 Plus
CG6980-PA 250 CG6980-PA 59..243 64..248 308 35.1 Plus
Stip1-PA 490 CG2720-PA 310..418 133..242 154 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10166-PA 244 GI10166-PA 19..244 30..250 520 44.9 Plus
Dmoj\GI22588-PA 226 GI22588-PA 5..224 31..248 467 45.5 Plus
Dmoj\GI13995-PA 206 GI13995-PA 2..205 36..249 397 39.7 Plus
Dmoj\GI24720-PA 233 GI24720-PA 90..232 107..249 385 49 Plus
Dmoj\GI23567-PA 209 GI23567-PA 61..205 80..246 277 37.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12700-PA 246 GL12700-PA 1..246 1..250 579 47.1 Plus
Dper\GL22045-PA 232 GL22045-PA 1..232 27..247 458 43.8 Plus
Dper\GL11931-PA 225 GL11931-PA 4..223 36..248 411 43.9 Plus
Dper\GL13629-PA 226 GL13629-PA 73..224 98..248 304 39.5 Plus
Dper\GL25924-PA 531 GL25924-PA 309..417 133..242 153 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27592-PA 246 GA27592-PA 1..246 1..250 577 47.1 Plus
Dpse\GA27357-PA 232 GA27357-PA 1..232 27..247 459 43.8 Plus
Dpse\GA16156-PA 225 GA16156-PA 4..223 36..248 413 43.9 Plus
Dpse\GA20001-PA 226 GA20001-PA 73..224 98..248 304 39.5 Plus
Dpse\GA15447-PA 489 GA15447-PA 309..417 133..242 152 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24250-PA 193 GM24250-PA 17..193 74..250 873 92.7 Plus
Dsec\GM10528-PA 239 GM10528-PA 1..239 27..247 476 45 Plus
Dsec\GM25756-PA 218 GM25756-PA 3..216 35..248 367 39.6 Plus
Dsec\GM26628-PA 245 GM26628-PA 102..243 107..248 293 41.5 Plus
Dsec\GM15022-PA 214 GM15022-PA 34..142 133..242 160 28.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19039-PA 248 GD19039-PA 1..248 3..250 1218 91.5 Plus
Dsim\GD20333-PA 225 GD20333-PA 3..223 35..248 438 44.1 Plus
Dsim\GD19523-PA 298 GD19523-PA 1..213 27..227 408 42.5 Plus
Dsim\GD21131-PA 245 GD21131-PA 102..243 107..248 295 41.5 Plus
Dsim\Hop-PA 490 GD23015-PA 310..418 133..242 157 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10868-PA 232 GJ10868-PA 6..232 32..249 558 49.1 Plus
Dvir\GJ10310-PA 229 GJ10310-PA 6..229 32..250 475 44 Plus
Dvir\GJ23936-PA 219 GJ23936-PA 1..216 27..248 433 40.8 Plus
Dvir\GJ10309-PA 228 GJ10309-PA 5..226 31..248 386 40.5 Plus
Dvir\GJ23542-PA 139 GJ23542-PA 1..135 112..246 308 45.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11411-PA 229 GK11411-PA 7..229 33..250 562 50 Plus
Dwil\GK10830-PA 229 GK10830-PA 1..227 27..246 473 43.8 Plus
Dwil\GK11681-PA 232 GK11681-PA 4..230 25..248 388 38.8 Plus
Dwil\GK14108-PA 225 GK14108-PA 82..223 107..248 321 43 Plus
Dwil\GK18373-PA 492 GK18373-PA 312..420 133..242 147 28.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24329-PA 250 GE24329-PA 1..250 1..250 1138 82.4 Plus
Dyak\GE26363-PA 225 GE26363-PA 3..223 35..248 452 45.5 Plus
Dyak\GE25831-PA 131 GE25831-PA 4..131 120..247 381 57 Plus
Dyak\GE23516-PA 244 GE23516-PA 101..242 107..248 308 43 Plus
Dyak\Hop-PA 490 GE16725-PA 310..418 133..242 156 27.3 Plus

IP18157.hyp Sequence

Translation from 41 to 793

> IP18157.hyp
MPLTTNTVDKKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVEDV
IEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAK
RALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFS
LAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEH
YLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDADFIDEFLDKMRSLL
*

IP18157.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34274-PA 250 CG34274-PA 1..250 1..250 1296 100 Plus
CG34297-PA 233 CG34297-PA 1..233 27..247 486 44.4 Plus
CG31294-PA 225 CG31294-PA 3..223 35..248 449 44.6 Plus
CG6980-PA 250 CG6980-PA 59..243 64..248 308 35.1 Plus
Hop-PA 490 CG2720-PA 310..418 133..242 154 28.2 Plus