Clone IP18174 Report

Search the DGRC for IP18174

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:181
Well:74
Vector:pOT2
Associated Gene/TranscriptCG34287-RA
Protein status:IP18174.pep: gold
Sequenced Size:971

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34287 2008-04-29 Release 5.5 accounting
CG34287 2008-08-15 Release 5.9 accounting
CG34287 2008-12-18 5.12 accounting

Clone Sequence Records

IP18174.complete Sequence

971 bp assembled on 2007-01-15

GenBank Submission: BT030223

> IP18174.complete
ATTATCAAACAGAAAACATCAAAAATATTTTTAAATAAAAGAAAAATACA
AAAAAAATTGCAAAATGGATCCAGTTCAACGGGAAAAGGAATTAATTAAA
ATGGAATTGCCAAGGACGAGGGTGCTTGTAACCACCAGCAGAGCGGATTA
TGTGGATCATACTGAAAGAGCCGTTTACAATCCCCCGATTAAGAAAACCC
AAGAGGATCCCTCTCTAATAAGTGGTCACTACTGCGCAAATCTAAAGGTT
GGTGGCATTGAATATAAAACAAAGACATGGCCCCAATCAATGGACTGGCG
GGAGGACTACGCACAGTTCATCAAGCGCAACAAGTGGTGTAACGAAAGGA
TCTACAAGCTATTTTTTATGTATCCGCCTGTGGATTTCCGAATTCTGAAG
GACTTTGTGAAGGACCTTCGTAGATCGGTGTACATGAACGATTACTCTCG
GAATGACTTCGTTTCTTTTGTAAGTCGACGGCGCTATAGGAACAAAAAAG
GTTACTCTCTCAAGGACGAGGACTATCGGACCACATATGGGTGCTATTAC
AATTTCCTGCAGGAAACGGAGCCGTTTAGGAGCTCCTTCTATCCAGAACG
TAGGCTAAAGGACACTACTCTGGACAAAATCGCCAGCGATTTACGAAAAA
TTTTCACAAAGTACAACTTGACCACCTATTTTGATACCATATGCGTTCCG
GCCTTGATGAAAGCTAAAAATAATGTAATGCCCTCCACACCCATCGACCG
GTATCAATTTCGCAAATATTAGCTGTGCTCCATACTTACACGTCTTCCCA
TTCGTGGAACAGTGGCAGCAAGCGGTTGGATTGCGCCACGGGTATAAAAA
TCATGGCGTATTTCAGGTATACATTCGAGTCCTACAAAAAAAAAAAGTGC
CAATATTATATGGTCGAATTTAATGCAATACGAGTAAAGCAACGGACAAA
TAAAAAAAAAAAAAAAAAAAA

IP18174.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34287-RA 951 CG34287-RA 1..951 1..951 4755 100 Plus
disp-RA 5067 disp-RA 1702..1794 881..789 465 100 Minus
CG14676-RA 958 CG14676-RA 312..398 274..360 270 87.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1678978..1679928 1..951 4755 100 Plus
chr3R 27901430 chr3R 1673177..1673263 274..360 270 87.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5853332..5854287 1..956 4765 99.9 Plus
3R 32079331 3R 5847531..5847617 274..360 270 87.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5594163..5595118 1..956 4765 99.8 Plus
3R 31820162 3R 5588362..5588448 274..360 270 87.3 Plus
Blast to na_te.dros performed on 2019-03-16 09:10:27 has no hits.

IP18174.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:11:07 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1678978..1679928 1..951 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:38 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..708 65..772 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:21 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..708 65..772 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:58:04 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..708 65..772 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:21:27 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..708 65..772 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:02:18 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..708 65..772 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:40:18 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..708 65..772 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:21 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..951 1..951 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:58:04 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..951 1..951 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:21:27 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..708 65..772 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:02:18 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
CG34287-RA 1..951 1..951 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:07 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5853332..5854282 1..951 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:07 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5853332..5854282 1..951 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:07 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5853332..5854282 1..951 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:58:04 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1679054..1680004 1..951 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:15 Download gff for IP18174.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5594163..5595113 1..951 100   Plus

IP18174.pep Sequence

Translation from 64 to 771

> IP18174.pep
MDPVQREKELIKMELPRTRVLVTTSRADYVDHTERAVYNPPIKKTQEDPS
LISGHYCANLKVGGIEYKTKTWPQSMDWREDYAQFIKRNKWCNERIYKLF
FMYPPVDFRILKDFVKDLRRSVYMNDYSRNDFVSFVSRRRYRNKKGYSLK
DEDYRTTYGCYYNFLQETEPFRSSFYPERRLKDTTLDKIASDLRKIFTKY
NLTTYFDTICVPALMKAKNNVMPSTPIDRYQFRKY*

IP18174.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16366-PA 241 GF16366-PA 20..241 15..235 781 63.1 Plus
Dana\GF16363-PA 246 GF16363-PA 23..246 15..235 575 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13094-PA 235 GG13094-PA 1..235 1..235 1124 88.5 Plus
Dere\GG13088-PA 243 GG13088-PA 7..243 2..235 623 51 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16277-PA 248 GH16277-PA 25..248 15..235 551 49.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34287-PA 235 CG34287-PA 1..235 1..235 1269 100 Plus
CG14676-PA 244 CG14676-PA 7..244 2..235 619 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22185-PA 205 GI22185-PA 6..205 37..235 481 47.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24039-PA 245 GL24039-PA 1..245 1..235 687 54.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13168-PA 245 GA13168-PA 1..245 1..235 676 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10849-PA 180 GM10849-PA 7..166 2..159 380 49.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19833-PA 235 GD19833-PA 1..235 1..235 1187 94 Plus
Dsim\GD19831-PA 244 GD19831-PA 7..244 2..235 609 50.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24304-PA 246 GJ24304-PA 19..246 11..235 536 46.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18939-PA 241 GK18939-PA 18..241 15..235 567 48.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10175-PA 243 GE10175-PA 7..243 2..235 608 49.8 Plus

IP18174.hyp Sequence

Translation from 64 to 771

> IP18174.hyp
MDPVQREKELIKMELPRTRVLVTTSRADYVDHTERAVYNPPIKKTQEDPS
LISGHYCANLKVGGIEYKTKTWPQSMDWREDYAQFIKRNKWCNERIYKLF
FMYPPVDFRILKDFVKDLRRSVYMNDYSRNDFVSFVSRRRYRNKKGYSLK
DEDYRTTYGCYYNFLQETEPFRSSFYPERRLKDTTLDKIASDLRKIFTKY
NLTTYFDTICVPALMKAKNNVMPSTPIDRYQFRKY*

IP18174.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34287-PA 235 CG34287-PA 1..235 1..235 1269 100 Plus
CG14676-PA 244 CG14676-PA 7..244 2..235 619 50.6 Plus