BDGP Sequence Production Resources |
Search the DGRC for IP18220
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 182 |
Well: | 20 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34247-RA |
Protein status: | IP18220.pep: gold |
Sequenced Size: | 386 |
Gene | Date | Evidence |
---|---|---|
CG34247 | 2008-04-29 | Release 5.5 accounting |
CG34247 | 2008-08-15 | Release 5.9 accounting |
CG34247 | 2008-12-18 | 5.12 accounting |
386 bp assembled on 2007-01-15
GenBank Submission: BT030229
> IP18220.complete TGATCTTCAAGGAACTGCAACGAGCGAAAATGAAGCTGCTGATCTTTGCC TGTTTGCTTGCTCTGGCTTTGGGGCACGAGGTGTATTACTATACCCCCAG CTATGGGTACTACCCCAGTACCTTTGCCAGGTCCTCGGCTGTCCTGCCCT TGGCCTATTCCCGTTTGATTGCCCCGGCAGCCGCCGAATCGCATCTTTAC CACAGCGTGGAGACCCCGAACTCCTTCCAGCAGCAATATCGCAGCGACTA CAAGCCCCTGACCTATGAGTACATCTACTAGATGGGCGGGGAGCAACAAA CCTTTGCGTGAATTGTAAGCAAGTGAAATTTGAATAAAGTTCGAACGCTC CTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16250860..16251174 | 39..353 | 99 | <- | Minus |
chr3L | 16251243..16251280 | 1..38 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..252 | 30..281 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..252 | 30..281 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..252 | 30..281 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..252 | 30..281 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..252 | 30..281 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..252 | 30..281 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..353 | 1..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..353 | 1..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..252 | 30..281 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34247-RA | 1..353 | 1..353 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16261185..16261499 | 39..353 | 100 | <- | Minus |
3L | 16261568..16261605 | 1..38 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16261185..16261499 | 39..353 | 100 | <- | Minus |
3L | 16261568..16261605 | 1..38 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16261185..16261499 | 39..353 | 100 | <- | Minus |
3L | 16261568..16261605 | 1..38 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16254285..16254599 | 39..353 | 100 | <- | Minus |
arm_3L | 16254668..16254705 | 1..38 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16254285..16254599 | 39..353 | 100 | <- | Minus |
3L | 16254668..16254705 | 1..38 | 100 | Minus |
Translation from 2 to 280
> IP18220.hyp IFKELQRAKMKLLIFACLLALALGHEVYYYTPSYGYYPSTFARSSAVLPL AYSRLIAPAAAESHLYHSVETPNSFQQQYRSDYKPLTYEYIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34247-PA | 83 | CG34247-PA | 1..83 | 10..92 | 437 | 100 | Plus |
Translation from 2 to 280
> IP18220.pep IFKELQRAKMKLLIFACLLALALGHEVYYYTPSYGYYPSTFARSSAVLPL AYSRLIAPAAAESHLYHSVETPNSFQQQYRSDYKPLTYEYIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10309-PA | 84 | GF10309-PA | 1..84 | 10..92 | 313 | 79.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13483-PA | 83 | GG13483-PA | 1..83 | 10..92 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15621-PA | 84 | GH15621-PA | 1..84 | 10..92 | 303 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34247-PA | 83 | CG34247-PA | 1..83 | 10..92 | 437 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12668-PA | 81 | GI12668-PA | 1..81 | 10..92 | 224 | 61.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18023-PA | 87 | GL18023-PA | 1..84 | 10..90 | 363 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28370-PA | 87 | GA28370-PA | 1..84 | 10..90 | 363 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24433-PA | 83 | GM24433-PA | 1..83 | 10..92 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12500-PA | 83 | GD12500-PA | 1..83 | 10..92 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12648-PA | 87 | GJ12648-PA | 1..87 | 10..92 | 253 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17649-PA | 88 | GK17649-PA | 1..88 | 10..92 | 267 | 64.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22575-PA | 83 | GE22575-PA | 1..83 | 10..92 | 347 | 96.4 | Plus |