Clone IP18220 Report

Search the DGRC for IP18220

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:182
Well:20
Vector:pOT2
Associated Gene/TranscriptCG34247-RA
Protein status:IP18220.pep: gold
Sequenced Size:386

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34247 2008-04-29 Release 5.5 accounting
CG34247 2008-08-15 Release 5.9 accounting
CG34247 2008-12-18 5.12 accounting

Clone Sequence Records

IP18220.complete Sequence

386 bp assembled on 2007-01-15

GenBank Submission: BT030229

> IP18220.complete
TGATCTTCAAGGAACTGCAACGAGCGAAAATGAAGCTGCTGATCTTTGCC
TGTTTGCTTGCTCTGGCTTTGGGGCACGAGGTGTATTACTATACCCCCAG
CTATGGGTACTACCCCAGTACCTTTGCCAGGTCCTCGGCTGTCCTGCCCT
TGGCCTATTCCCGTTTGATTGCCCCGGCAGCCGCCGAATCGCATCTTTAC
CACAGCGTGGAGACCCCGAACTCCTTCCAGCAGCAATATCGCAGCGACTA
CAAGCCCCTGACCTATGAGTACATCTACTAGATGGGCGGGGAGCAACAAA
CCTTTGCGTGAATTGTAAGCAAGTGAAATTTGAATAAAGTTCGAACGCTC
CTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP18220.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-RA 564 CG34247-RA 32..385 1..354 1770 100 Plus
CG34247.a 414 CG34247.a 32..345 1..314 1570 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16250860..16251175 353..38 1565 99.7 Minus
chr3L 24539361 chr3L 16251239..16251280 42..1 195 97.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16261184..16261500 354..38 1585 100 Minus
3L 28110227 3L 16261564..16261605 42..1 195 97.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16254284..16254600 354..38 1585 100 Minus
3L 28103327 3L 16254664..16254705 42..1 195 97.6 Minus
Blast to na_te.dros performed on 2019-03-16 10:51:03 has no hits.

IP18220.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:52:01 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16250860..16251174 39..353 99 <- Minus
chr3L 16251243..16251280 1..38 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:11:44 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..252 30..281 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:43 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..252 30..281 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:13 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..252 30..281 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:24 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..252 30..281 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:06 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..252 30..281 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:30 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..252 30..281 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:43 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..353 1..353 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:13 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..353 1..353 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:24 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..252 30..281 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:06 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..353 1..353 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:01 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16261185..16261499 39..353 100 <- Minus
3L 16261568..16261605 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:01 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16261185..16261499 39..353 100 <- Minus
3L 16261568..16261605 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:01 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16261185..16261499 39..353 100 <- Minus
3L 16261568..16261605 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:13 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16254285..16254599 39..353 100 <- Minus
arm_3L 16254668..16254705 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:29 Download gff for IP18220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16254285..16254599 39..353 100 <- Minus
3L 16254668..16254705 1..38 100   Minus

IP18220.hyp Sequence

Translation from 2 to 280

> IP18220.hyp
IFKELQRAKMKLLIFACLLALALGHEVYYYTPSYGYYPSTFARSSAVLPL
AYSRLIAPAAAESHLYHSVETPNSFQQQYRSDYKPLTYEYIY*

IP18220.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-PA 83 CG34247-PA 1..83 10..92 437 100 Plus

IP18220.pep Sequence

Translation from 2 to 280

> IP18220.pep
IFKELQRAKMKLLIFACLLALALGHEVYYYTPSYGYYPSTFARSSAVLPL
AYSRLIAPAAAESHLYHSVETPNSFQQQYRSDYKPLTYEYIY*

IP18220.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10309-PA 84 GF10309-PA 1..84 10..92 313 79.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13483-PA 83 GG13483-PA 1..83 10..92 420 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15621-PA 84 GH15621-PA 1..84 10..92 303 72.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-PA 83 CG34247-PA 1..83 10..92 437 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12668-PA 81 GI12668-PA 1..81 10..92 224 61.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18023-PA 87 GL18023-PA 1..84 10..90 363 88.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28370-PA 87 GA28370-PA 1..84 10..90 363 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24433-PA 83 GM24433-PA 1..83 10..92 420 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12500-PA 83 GD12500-PA 1..83 10..92 420 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12648-PA 87 GJ12648-PA 1..87 10..92 253 67.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17649-PA 88 GK17649-PA 1..88 10..92 267 64.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22575-PA 83 GE22575-PA 1..83 10..92 347 96.4 Plus