IP18228.complete Sequence
614 bp assembled on 2007-01-15
GenBank Submission: BT030231
> IP18228.complete
TTTAAAGATCTAACCTAATGGAATCACTCGCAAAATATCGATACAGTTTG
GTGGCTGGCTCCTTCGCAGCTGCAGGAAGCTTTTTCGGAAAACTTCCCAG
CCACCTGAGCGCCCAAAAACTACTGAATACTTCGCAAATAAATGAAGACT
TTTCTTATTTAGAAATAGCATTACTTCAGCTGCTGCCACTAGTGTTAATG
GTAACATGCAACGTTTGCAACTTGCGTTTCTTTTTGAAGGCCCTGCAAAT
GACTGAACAAACTTTAACGTGCGTCGTTTTAACTGCCGCTTCGAATTATG
TCTTATCGTTTGTCCTAGGTGCGCTTGTTTATCGGGAGCCACTGACAGTA
CTATCTGGCATCGGAATAACTCTCATTCTGGCTGGTCTTTGGTTTCTTTG
CGACGGAGGAACAGTCGAGTCCGAAAAGCAGGACAAAATGGAATAGTAGG
AATGGGATTTGCTTAAGATTAGCTTCTTTTATACACATTTTTCATTTGCC
ATATAACTTTCTGAAGCAGGGATAAAAATAGTTAAAGAAACTTAATTTTC
CATTTGTAACTTTAAAATATAAAAATGTTGGGAACCCCAATTAGTCCAAA
AAAAAAAAAAAAAA
IP18228.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:04:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42495-RA | 670 | CG42495-RA | 67..670 | 1..604 | 3020 | 100 | Plus |
CG42495.a | 660 | CG42495.a | 67..374 | 1..308 | 1540 | 100 | Plus |
CG42495.a | 660 | CG42495.a | 374..660 | 318..604 | 1435 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:51:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 18657515..18657801 | 304..597 | 1225 | 95.2 | Plus |
chr3L | 24539361 | chr3L | 18657091..18657252 | 1..162 | 750 | 97.5 | Plus |
chr3L | 24539361 | chr3L | 18657317..18657466 | 159..308 | 750 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:51:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 18667842..18668142 | 304..604 | 1490 | 99.7 | Plus |
3L | 28110227 | 3L | 18667418..18667579 | 1..162 | 810 | 100 | Plus |
3L | 28110227 | 3L | 18667644..18667793 | 159..308 | 750 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 18660942..18661242 | 304..604 | 1490 | 99.6 | Plus |
3L | 28103327 | 3L | 18660518..18660679 | 1..162 | 810 | 100 | Plus |
3L | 28103327 | 3L | 18660744..18660893 | 159..308 | 750 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 10:51:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
1360 | 3409 | 1360 1360 3409bp | 2411..2529 | 592..459 | 116 | 60.3 | Minus |
412 | 7567 | 412 412 7567bp | 1430..1486 | 521..576 | 111 | 68.4 | Plus |
IP18228.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:52:06 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 18657327..18657466 | 169..308 | 100 | -> | Plus |
chr3L | 18657091..18657257 | 1..168 | 95 | -> | Plus |
chr3L | 18657520..18657801 | 309..597 | 95 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:39 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42495-RA | 1..429 | 18..446 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:16 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42495-RA | 1..429 | 18..446 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:19 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10505-RA | 16..34 | 412..431 | 95 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:19 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42495-RA | 1..429 | 18..446 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:39 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42495-RA | 58..654 | 1..597 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:16 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42495-RA | 58..654 | 1..597 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:04:20 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:19 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42495-RA | 58..654 | 1..597 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:06 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18667648..18667793 | 163..308 | 100 | -> | Plus |
3L | 18667847..18668135 | 309..597 | 100 | | Plus |
3L | 18667418..18667579 | 1..162 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:06 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18667648..18667793 | 163..308 | 100 | -> | Plus |
3L | 18667847..18668135 | 309..597 | 100 | | Plus |
3L | 18667418..18667579 | 1..162 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:06 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18667648..18667793 | 163..308 | 100 | -> | Plus |
3L | 18667847..18668135 | 309..597 | 100 | | Plus |
3L | 18667418..18667579 | 1..162 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:16 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 18660518..18660679 | 1..162 | 100 | -> | Plus |
arm_3L | 18660748..18660893 | 163..308 | 100 | -> | Plus |
arm_3L | 18660947..18661235 | 309..597 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:54 Download gff for
IP18228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18660518..18660679 | 1..162 | 100 | -> | Plus |
3L | 18660748..18660893 | 163..308 | 100 | -> | Plus |
3L | 18660947..18661235 | 309..597 | 100 | | Plus |
IP18228.hyp Sequence
Translation from 17 to 445
> IP18228.hyp
MESLAKYRYSLVAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEI
ALLQLLPLVLMVTCNVCNLRFFLKALQMTEQTLTCVVLTAASNYVLSFVL
GALVYREPLTVLSGIGITLILAGLWFLCDGGTVESEKQDKME*
IP18228.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:55:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42495-PA | 142 | CG42495-PA | 1..142 | 1..142 | 709 | 100 | Plus |
IP18228.pep Sequence
Translation from 17 to 445
> IP18228.pep
MESLAKYRYSLVAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEI
ALLQLLPLVLMVTCNVCNLRFFLKALQMTEQTLTCVVLTAASNYVLSFVL
GALVYREPLTVLSGIGITLILAGLWFLCDGGTVESEKQDKME*
IP18228.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42495-PA | 142 | CG42495-PA | 1..142 | 1..142 | 709 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:25:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL22886-PA | 111 | GL22886-PA | 1..101 | 1..97 | 327 | 79.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:25:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA23913-PA | 109 | GA23913-PA | 1..101 | 1..97 | 326 | 79.2 | Plus |