Clone IP18228 Report

Search the DGRC for IP18228

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:182
Well:28
Vector:pOT2
Associated Gene/TranscriptCG42495-RA
Protein status:IP18228.pep: gold
Sequenced Size:614

Clone Sequence Records

IP18228.complete Sequence

614 bp assembled on 2007-01-15

GenBank Submission: BT030231

> IP18228.complete
TTTAAAGATCTAACCTAATGGAATCACTCGCAAAATATCGATACAGTTTG
GTGGCTGGCTCCTTCGCAGCTGCAGGAAGCTTTTTCGGAAAACTTCCCAG
CCACCTGAGCGCCCAAAAACTACTGAATACTTCGCAAATAAATGAAGACT
TTTCTTATTTAGAAATAGCATTACTTCAGCTGCTGCCACTAGTGTTAATG
GTAACATGCAACGTTTGCAACTTGCGTTTCTTTTTGAAGGCCCTGCAAAT
GACTGAACAAACTTTAACGTGCGTCGTTTTAACTGCCGCTTCGAATTATG
TCTTATCGTTTGTCCTAGGTGCGCTTGTTTATCGGGAGCCACTGACAGTA
CTATCTGGCATCGGAATAACTCTCATTCTGGCTGGTCTTTGGTTTCTTTG
CGACGGAGGAACAGTCGAGTCCGAAAAGCAGGACAAAATGGAATAGTAGG
AATGGGATTTGCTTAAGATTAGCTTCTTTTATACACATTTTTCATTTGCC
ATATAACTTTCTGAAGCAGGGATAAAAATAGTTAAAGAAACTTAATTTTC
CATTTGTAACTTTAAAATATAAAAATGTTGGGAACCCCAATTAGTCCAAA
AAAAAAAAAAAAAA

IP18228.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG42495-RA 670 CG42495-RA 67..670 1..604 3020 100 Plus
CG42495.a 660 CG42495.a 67..374 1..308 1540 100 Plus
CG42495.a 660 CG42495.a 374..660 318..604 1435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18657515..18657801 304..597 1225 95.2 Plus
chr3L 24539361 chr3L 18657091..18657252 1..162 750 97.5 Plus
chr3L 24539361 chr3L 18657317..18657466 159..308 750 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18667842..18668142 304..604 1490 99.7 Plus
3L 28110227 3L 18667418..18667579 1..162 810 100 Plus
3L 28110227 3L 18667644..18667793 159..308 750 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18660942..18661242 304..604 1490 99.6 Plus
3L 28103327 3L 18660518..18660679 1..162 810 100 Plus
3L 28103327 3L 18660744..18660893 159..308 750 100 Plus
Blast to na_te.dros performed 2019-03-16 10:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 2411..2529 592..459 116 60.3 Minus
412 7567 412 412 7567bp 1430..1486 521..576 111 68.4 Plus

IP18228.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:52:06 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18657327..18657466 169..308 100 -> Plus
chr3L 18657091..18657257 1..168 95 -> Plus
chr3L 18657520..18657801 309..597 95   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:39 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
CG42495-RA 1..429 18..446 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:16 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
CG42495-RA 1..429 18..446 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:19 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
CG10505-RA 16..34 412..431 95   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:19 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
CG42495-RA 1..429 18..446 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:39 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
CG42495-RA 58..654 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:16 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
CG42495-RA 58..654 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:04:20 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:19 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
CG42495-RA 58..654 1..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:06 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18667648..18667793 163..308 100 -> Plus
3L 18667847..18668135 309..597 100   Plus
3L 18667418..18667579 1..162 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:06 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18667648..18667793 163..308 100 -> Plus
3L 18667847..18668135 309..597 100   Plus
3L 18667418..18667579 1..162 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:06 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18667648..18667793 163..308 100 -> Plus
3L 18667847..18668135 309..597 100   Plus
3L 18667418..18667579 1..162 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:16 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18660518..18660679 1..162 100 -> Plus
arm_3L 18660748..18660893 163..308 100 -> Plus
arm_3L 18660947..18661235 309..597 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:54 Download gff for IP18228.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18660518..18660679 1..162 100 -> Plus
3L 18660748..18660893 163..308 100 -> Plus
3L 18660947..18661235 309..597 100   Plus

IP18228.hyp Sequence

Translation from 17 to 445

> IP18228.hyp
MESLAKYRYSLVAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEI
ALLQLLPLVLMVTCNVCNLRFFLKALQMTEQTLTCVVLTAASNYVLSFVL
GALVYREPLTVLSGIGITLILAGLWFLCDGGTVESEKQDKME*

IP18228.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42495-PA 142 CG42495-PA 1..142 1..142 709 100 Plus

IP18228.pep Sequence

Translation from 17 to 445

> IP18228.pep
MESLAKYRYSLVAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEI
ALLQLLPLVLMVTCNVCNLRFFLKALQMTEQTLTCVVLTAASNYVLSFVL
GALVYREPLTVLSGIGITLILAGLWFLCDGGTVESEKQDKME*

IP18228.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42495-PA 142 CG42495-PA 1..142 1..142 709 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22886-PA 111 GL22886-PA 1..101 1..97 327 79.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23913-PA 109 GA23913-PA 1..101 1..97 326 79.2 Plus