IP18279.complete Sequence
478 bp assembled on 2007-01-15
GenBank Submission: BT030241
> IP18279.complete
AGCAAATTAGCCCACTCGTCCCGAGAATCAGTAAAGAGTATACCATAATG
GGTTGTTGTTTTGGCAAAAGTAAATCAGTCGATTTGCCCGCGGTTCCGCC
GGCTCCAGCCAAACAACGCTCCACTCTGCCAGAATTCCCGATTTCTGGAT
CGGTGACTAGCACGGCTCCTGCAGGATCTGGATATGGATCTGGAGGAGCC
ACCAATGCGGCCCTCGAGGATGACTAGACGTGGTTAAAGGAACAGAAAAA
ACGTTCACGTCCAGGGAAAACTGTAAATTTGCCAAATGGCAGATTGGATT
ATGAGTCATTCCGTGCCGAGATGTGGTTTTTTCAAAGTTGTGCACCCTTT
GTAGTTAGTATTGTAGTAAAATACGTTGTTTATTGTTGGAGAGTATAAAA
TTGTTGGTAAATTAAATCATAACTTTAATCTCTTTGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
IP18279.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34288-RB | 695 | CG34288-RB | 227..664 | 1..438 | 2190 | 100 | Plus |
CG34288.a | 605 | CG34288.a | 170..605 | 1..436 | 2180 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:09:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 18270299..18270674 | 436..63 | 1740 | 98.1 | Minus |
chr3R | 27901430 | chr3R | 18270738..18270801 | 64..1 | 320 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:09:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 22446761..22447136 | 438..63 | 1880 | 100 | Minus |
3R | 32079331 | 3R | 22447200..22447263 | 64..1 | 320 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 22187592..22187967 | 438..63 | 1880 | 100 | Minus |
3R | 31820162 | 3R | 22188031..22188094 | 64..1 | 320 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 09:09:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
INE-1 | 611 | INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). | 383..419 | 393..429 | 113 | 78.4 | Plus |
gypsy6 | 7826 | gypsy6 GYPSY6 7826bp | 5472..5554 | 191..271 | 103 | 61.4 | Plus |
IP18279.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:10:44 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 18270299..18270673 | 64..436 | 98 | <- | Minus |
chr3R | 18270739..18270801 | 1..63 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:12:04 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RA | 22..186 | 63..227 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:30 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 1..180 | 48..227 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:57:40 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 1..180 | 48..227 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:42 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RA | 22..186 | 63..227 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:11 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 1..180 | 48..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:44 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RA | 22..186 | 63..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:30 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 1..436 | 1..436 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:57:40 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 1..436 | 1..436 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:42 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RA | 22..186 | 63..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:11 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34288-RB | 1..436 | 1..436 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:44 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22446763..22447135 | 64..436 | 100 | <- | Minus |
3R | 22447201..22447263 | 1..63 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:44 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22446763..22447135 | 64..436 | 100 | <- | Minus |
3R | 22447201..22447263 | 1..63 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:44 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22446763..22447135 | 64..436 | 100 | <- | Minus |
3R | 22447201..22447263 | 1..63 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:57:40 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 18272485..18272857 | 64..436 | 100 | <- | Minus |
arm_3R | 18272923..18272985 | 1..63 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:05 Download gff for
IP18279.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22187594..22187966 | 64..436 | 100 | <- | Minus |
3R | 22188032..22188094 | 1..63 | 100 | | Minus |
IP18279.hyp Sequence
Translation from 2 to 226
> IP18279.hyp
QISPLVPRISKEYTIMGCCFGKSKSVDLPAVPPAPAKQRSTLPEFPISGS
VTSTAPAGSGYGSGGATNAALEDD*
IP18279.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34288-PB | 59 | CG34288-PB | 1..59 | 16..74 | 310 | 100 | Plus |
IP18279.pep Sequence
Translation from 2 to 226
> IP18279.pep
QISPLVPRISKEYTIMGCCFGKSKSVDLPAVPPAPAKQRSTLPEFPISGS
VTSTAPAGSGYGSGGATNAALEDD*
IP18279.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:22:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF16565-PA | 57 | GF16565-PA | 1..57 | 16..74 | 205 | 71.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:22:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12514-PA | 59 | GG12514-PA | 1..59 | 16..74 | 285 | 93.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34288-PB | 59 | CG34288-PB | 1..59 | 16..74 | 310 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:22:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA30246-PA | 54 | GA30246-PA | 1..54 | 16..74 | 182 | 71.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:22:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23648-PA | 59 | GM23648-PA | 1..59 | 16..74 | 224 | 93.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:22:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18458-PA | 59 | GD18458-PA | 1..59 | 16..74 | 228 | 94.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:22:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24037-PA | 61 | GE24037-PA | 8..61 | 21..74 | 198 | 92.6 | Plus |