Clone IP18279 Report

Search the DGRC for IP18279

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:182
Well:79
Vector:pOT2
Associated Gene/TranscriptCG34288-RB
Protein status:IP18279.pep: gold
Sequenced Size:478

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34288 2008-04-29 Release 5.5 accounting
CG34288 2008-08-15 Release 5.9 accounting
CG34288 2008-12-18 5.12 accounting

Clone Sequence Records

IP18279.complete Sequence

478 bp assembled on 2007-01-15

GenBank Submission: BT030241

> IP18279.complete
AGCAAATTAGCCCACTCGTCCCGAGAATCAGTAAAGAGTATACCATAATG
GGTTGTTGTTTTGGCAAAAGTAAATCAGTCGATTTGCCCGCGGTTCCGCC
GGCTCCAGCCAAACAACGCTCCACTCTGCCAGAATTCCCGATTTCTGGAT
CGGTGACTAGCACGGCTCCTGCAGGATCTGGATATGGATCTGGAGGAGCC
ACCAATGCGGCCCTCGAGGATGACTAGACGTGGTTAAAGGAACAGAAAAA
ACGTTCACGTCCAGGGAAAACTGTAAATTTGCCAAATGGCAGATTGGATT
ATGAGTCATTCCGTGCCGAGATGTGGTTTTTTCAAAGTTGTGCACCCTTT
GTAGTTAGTATTGTAGTAAAATACGTTGTTTATTGTTGGAGAGTATAAAA
TTGTTGGTAAATTAAATCATAACTTTAATCTCTTTGAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP18279.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-RB 695 CG34288-RB 227..664 1..438 2190 100 Plus
CG34288.a 605 CG34288.a 170..605 1..436 2180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18270299..18270674 436..63 1740 98.1 Minus
chr3R 27901430 chr3R 18270738..18270801 64..1 320 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22446761..22447136 438..63 1880 100 Minus
3R 32079331 3R 22447200..22447263 64..1 320 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22187592..22187967 438..63 1880 100 Minus
3R 31820162 3R 22188031..22188094 64..1 320 100 Minus
Blast to na_te.dros performed 2019-03-16 09:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 383..419 393..429 113 78.4 Plus
gypsy6 7826 gypsy6 GYPSY6 7826bp 5472..5554 191..271 103 61.4 Plus

IP18279.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:10:44 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18270299..18270673 64..436 98 <- Minus
chr3R 18270739..18270801 1..63 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:12:04 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RA 22..186 63..227 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:30 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 1..180 48..227 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:57:40 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 1..180 48..227 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:42 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RA 22..186 63..227 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:11 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 1..180 48..227 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:44 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RA 22..186 63..227 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:30 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:57:40 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:42 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RA 22..186 63..227 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:11 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
CG34288-RB 1..436 1..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:44 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22446763..22447135 64..436 100 <- Minus
3R 22447201..22447263 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:44 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22446763..22447135 64..436 100 <- Minus
3R 22447201..22447263 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:44 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22446763..22447135 64..436 100 <- Minus
3R 22447201..22447263 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:57:40 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18272485..18272857 64..436 100 <- Minus
arm_3R 18272923..18272985 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:05 Download gff for IP18279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22187594..22187966 64..436 100 <- Minus
3R 22188032..22188094 1..63 100   Minus

IP18279.hyp Sequence

Translation from 2 to 226

> IP18279.hyp
QISPLVPRISKEYTIMGCCFGKSKSVDLPAVPPAPAKQRSTLPEFPISGS
VTSTAPAGSGYGSGGATNAALEDD*

IP18279.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-PB 59 CG34288-PB 1..59 16..74 310 100 Plus

IP18279.pep Sequence

Translation from 2 to 226

> IP18279.pep
QISPLVPRISKEYTIMGCCFGKSKSVDLPAVPPAPAKQRSTLPEFPISGS
VTSTAPAGSGYGSGGATNAALEDD*

IP18279.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16565-PA 57 GF16565-PA 1..57 16..74 205 71.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12514-PA 59 GG12514-PA 1..59 16..74 285 93.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34288-PB 59 CG34288-PB 1..59 16..74 310 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30246-PA 54 GA30246-PA 1..54 16..74 182 71.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23648-PA 59 GM23648-PA 1..59 16..74 224 93.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18458-PA 59 GD18458-PA 1..59 16..74 228 94.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24037-PA 61 GE24037-PA 8..61 21..74 198 92.6 Plus