BDGP Sequence Production Resources |
Search the DGRC for IP18284
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 182 |
Well: | 84 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34150-RB |
Protein status: | IP18284.pep: gold |
Sequenced Size: | 538 |
Gene | Date | Evidence |
---|---|---|
CG34150 | 2008-04-29 | Release 5.5 accounting |
CG34150 | 2008-08-15 | Release 5.9 accounting |
CG34150 | 2008-12-18 | 5.12 accounting |
538 bp assembled on 2007-01-15
GenBank Submission: BT030243
> IP18284.complete CAAAAATGTCCAATTTGCGGCGCCAGGTTCTCAGTGCTTTCAAGAAGCTC CACCGTACACGACAATACGTTTTTCAGGGGGATGCCAATGCTTTGGCGGC GGGACGACTAAAAATCAACGAATCTTTCCTGCAGAATCGTAATGAAAGCA GCGAGGATGAAATTCAAAAGATGATCAAGCTGGCGCAGGACGTGGATTTG GAGCTGCGAACGAATGTCATCCAAGCCCAGAAAAAAGAGGATGGTGTTTA TGAACTAAGGATCACGCCAGAGACAACGCGACTCGACAATGTGGTCTTTA ATCCTGACGCAATTATCGAAAAACCGCGCAGGCAACGCGGCGACAAAAAC ACTGAAGGTTGCTGCGGTGGCGCTGCGATGGCGGCGCTGGAAGCCGAAGT CCAGGCCCGCAACAAATAAAAATATATTCAATATTTAGCTGTAGTCAAGA TGGTTTTGTTCTGATTAATTACGTCGTTTATCTTTAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 20637935..20638168 | 252..485 | 1170 | 100 | Plus |
chr3R | 27901430 | chr3R | 20637583..20637730 | 23..170 | 740 | 100 | Plus |
chr3R | 27901430 | chr3R | 20637789..20637872 | 169..252 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 24814697..24814932 | 252..487 | 1180 | 100 | Plus |
3R | 32079331 | 3R | 24814345..24814492 | 23..170 | 740 | 100 | Plus |
3R | 32079331 | 3R | 24814551..24814634 | 169..252 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 24555528..24555763 | 252..487 | 1180 | 100 | Plus |
3R | 31820162 | 3R | 24555176..24555323 | 23..170 | 740 | 100 | Plus |
3R | 31820162 | 3R | 24555382..24555465 | 169..252 | 420 | 100 | Plus |
3R | 31820162 | 3R | 24555103..24555130 | 1..28 | 140 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 20637936..20638168 | 253..485 | 100 | Plus | |
chr3R | 20637510..20637535 | 1..26 | 100 | -> | Plus |
chr3R | 20637587..20637730 | 27..170 | 100 | -> | Plus |
chr3R | 20637791..20637872 | 171..252 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RA | 1..240 | 6..245 | 100 | == | Plus |
CG34150-RA | 241..387 | 273..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RB | 1..414 | 6..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RB | 1..414 | 6..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RA | 1..240 | 6..245 | 100 | == | Plus |
CG34150-RA | 241..387 | 273..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RB | 1..414 | 6..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RA | 241..387 | 273..419 | 100 | Plus | |
CG34150-RA | 1..240 | 6..245 | 100 | == | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RB | 11..495 | 1..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RB | 11..495 | 1..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RA | 1..240 | 6..245 | 100 | == | Plus |
CG34150-RA | 241..387 | 273..419 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34150-RB | 11..495 | 1..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24814272..24814297 | 1..26 | 100 | -> | Plus |
3R | 24814349..24814492 | 27..170 | 100 | -> | Plus |
3R | 24814553..24814634 | 171..252 | 100 | -> | Plus |
3R | 24814698..24814930 | 253..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24814272..24814297 | 1..26 | 100 | -> | Plus |
3R | 24814349..24814492 | 27..170 | 100 | -> | Plus |
3R | 24814553..24814634 | 171..252 | 100 | -> | Plus |
3R | 24814698..24814930 | 253..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24814272..24814297 | 1..26 | 100 | -> | Plus |
3R | 24814349..24814492 | 27..170 | 100 | -> | Plus |
3R | 24814553..24814634 | 171..252 | 100 | -> | Plus |
3R | 24814698..24814930 | 253..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 20639994..20640019 | 1..26 | 100 | -> | Plus |
arm_3R | 20640071..20640214 | 27..170 | 100 | -> | Plus |
arm_3R | 20640275..20640356 | 171..252 | 100 | -> | Plus |
arm_3R | 20640420..20640652 | 253..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24555103..24555128 | 1..26 | 100 | -> | Plus |
3R | 24555180..24555323 | 27..170 | 100 | -> | Plus |
3R | 24555384..24555465 | 171..252 | 100 | -> | Plus |
3R | 24555529..24555761 | 253..485 | 100 | Plus |
Translation from 2 to 418
> IP18284.hyp KMSNLRRQVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESS EDEIQKMIKLAQDVDLELRTNVIQAQKKEDGVYELRITPETTRLDNVVFN PDAIIEKPRRQRGDKNTEGCCGGAAMAALEAEVQARNK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34150-PB | 137 | CG34150-PB | 1..137 | 2..138 | 689 | 100 | Plus |
Translation from 2 to 418
> IP18284.pep KMSNLRRQVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESS EDEIQKMIKLAQDVDLELRTNVIQAQKKEDGVYELRITPETTRLDNVVFN PDAIIEKPRRQRGDKNTEGCCGGAAMAALEAEVQARNK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16242-PA | 137 | GF16242-PA | 1..137 | 2..138 | 642 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11321-PA | 137 | GG11321-PA | 1..137 | 2..138 | 700 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19114-PA | 82 | GH19114-PA | 1..81 | 57..138 | 266 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34150-PB | 137 | CG34150-PB | 1..137 | 2..138 | 689 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23568-PA | 138 | GI23568-PA | 5..138 | 5..138 | 543 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13630-PA | 137 | GL13630-PA | 1..137 | 2..138 | 529 | 74.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26851-PA | 137 | GA26851-PA | 1..137 | 2..138 | 524 | 73.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26629-PA | 137 | GM26629-PA | 1..137 | 2..138 | 715 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21132-PA | 137 | GD21132-PA | 1..137 | 2..138 | 720 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23543-PA | 81 | GJ23543-PA | 1..81 | 57..138 | 327 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14109-PA | 136 | GK14109-PA | 1..136 | 2..138 | 511 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23517-PA | 137 | GE23517-PA | 1..137 | 2..138 | 711 | 98.5 | Plus |