Clone IP18284 Report

Search the DGRC for IP18284

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:182
Well:84
Vector:pOT2
Associated Gene/TranscriptCG34150-RB
Protein status:IP18284.pep: gold
Sequenced Size:538

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34150 2008-04-29 Release 5.5 accounting
CG34150 2008-08-15 Release 5.9 accounting
CG34150 2008-12-18 5.12 accounting

Clone Sequence Records

IP18284.complete Sequence

538 bp assembled on 2007-01-15

GenBank Submission: BT030243

> IP18284.complete
CAAAAATGTCCAATTTGCGGCGCCAGGTTCTCAGTGCTTTCAAGAAGCTC
CACCGTACACGACAATACGTTTTTCAGGGGGATGCCAATGCTTTGGCGGC
GGGACGACTAAAAATCAACGAATCTTTCCTGCAGAATCGTAATGAAAGCA
GCGAGGATGAAATTCAAAAGATGATCAAGCTGGCGCAGGACGTGGATTTG
GAGCTGCGAACGAATGTCATCCAAGCCCAGAAAAAAGAGGATGGTGTTTA
TGAACTAAGGATCACGCCAGAGACAACGCGACTCGACAATGTGGTCTTTA
ATCCTGACGCAATTATCGAAAAACCGCGCAGGCAACGCGGCGACAAAAAC
ACTGAAGGTTGCTGCGGTGGCGCTGCGATGGCGGCGCTGGAAGCCGAAGT
CCAGGCCCGCAACAAATAAAAATATATTCAATATTTAGCTGTAGTCAAGA
TGGTTTTGTTCTGATTAATTACGTCGTTTATCTTTAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP18284.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34150-RB 633 CG34150-RB 148..633 1..486 2430 100 Plus
CG5808-RA 2263 CG5808-RA 2104..2263 487..328 800 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20637935..20638168 252..485 1170 100 Plus
chr3R 27901430 chr3R 20637583..20637730 23..170 740 100 Plus
chr3R 27901430 chr3R 20637789..20637872 169..252 420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24814697..24814932 252..487 1180 100 Plus
3R 32079331 3R 24814345..24814492 23..170 740 100 Plus
3R 32079331 3R 24814551..24814634 169..252 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24555528..24555763 252..487 1180 100 Plus
3R 31820162 3R 24555176..24555323 23..170 740 100 Plus
3R 31820162 3R 24555382..24555465 169..252 420 100 Plus
3R 31820162 3R 24555103..24555130 1..28 140 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:26:14 has no hits.

IP18284.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:27:01 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20637936..20638168 253..485 100   Plus
chr3R 20637510..20637535 1..26 100 -> Plus
chr3R 20637587..20637730 27..170 100 -> Plus
chr3R 20637791..20637872 171..252 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:12:08 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RA 1..240 6..245 100 == Plus
CG34150-RA 241..387 273..419 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:42 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RB 1..414 6..419 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:59 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RB 1..414 6..419 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:54 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RA 1..240 6..245 100 == Plus
CG34150-RA 241..387 273..419 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:27:54 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RB 1..414 6..419 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:58 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RA 241..387 273..419 100   Plus
CG34150-RA 1..240 6..245 100 == Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:42 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RB 11..495 1..485 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:59 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RB 11..495 1..485 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:55 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RA 1..240 6..245 100 == Plus
CG34150-RA 241..387 273..419 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:27:54 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
CG34150-RB 11..495 1..485 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:01 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24814272..24814297 1..26 100 -> Plus
3R 24814349..24814492 27..170 100 -> Plus
3R 24814553..24814634 171..252 100 -> Plus
3R 24814698..24814930 253..485 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:01 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24814272..24814297 1..26 100 -> Plus
3R 24814349..24814492 27..170 100 -> Plus
3R 24814553..24814634 171..252 100 -> Plus
3R 24814698..24814930 253..485 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:01 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24814272..24814297 1..26 100 -> Plus
3R 24814349..24814492 27..170 100 -> Plus
3R 24814553..24814634 171..252 100 -> Plus
3R 24814698..24814930 253..485 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:59 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20639994..20640019 1..26 100 -> Plus
arm_3R 20640071..20640214 27..170 100 -> Plus
arm_3R 20640275..20640356 171..252 100 -> Plus
arm_3R 20640420..20640652 253..485 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:12 Download gff for IP18284.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24555103..24555128 1..26 100 -> Plus
3R 24555180..24555323 27..170 100 -> Plus
3R 24555384..24555465 171..252 100 -> Plus
3R 24555529..24555761 253..485 100   Plus

IP18284.hyp Sequence

Translation from 2 to 418

> IP18284.hyp
KMSNLRRQVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESS
EDEIQKMIKLAQDVDLELRTNVIQAQKKEDGVYELRITPETTRLDNVVFN
PDAIIEKPRRQRGDKNTEGCCGGAAMAALEAEVQARNK*

IP18284.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34150-PB 137 CG34150-PB 1..137 2..138 689 100 Plus

IP18284.pep Sequence

Translation from 2 to 418

> IP18284.pep
KMSNLRRQVLSAFKKLHRTRQYVFQGDANALAAGRLKINESFLQNRNESS
EDEIQKMIKLAQDVDLELRTNVIQAQKKEDGVYELRITPETTRLDNVVFN
PDAIIEKPRRQRGDKNTEGCCGGAAMAALEAEVQARNK*

IP18284.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16242-PA 137 GF16242-PA 1..137 2..138 642 89.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11321-PA 137 GG11321-PA 1..137 2..138 700 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19114-PA 82 GH19114-PA 1..81 57..138 266 74.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34150-PB 137 CG34150-PB 1..137 2..138 689 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23568-PA 138 GI23568-PA 5..138 5..138 543 76.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13630-PA 137 GL13630-PA 1..137 2..138 529 74.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26851-PA 137 GA26851-PA 1..137 2..138 524 73.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26629-PA 137 GM26629-PA 1..137 2..138 715 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21132-PA 137 GD21132-PA 1..137 2..138 720 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23543-PA 81 GJ23543-PA 1..81 57..138 327 74.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14109-PA 136 GK14109-PA 1..136 2..138 511 72.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23517-PA 137 GE23517-PA 1..137 2..138 711 98.5 Plus