Clone IP18308 Report

Search the DGRC for IP18308

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:183
Well:8
Vector:pOT2
Associated Gene/TranscriptCG43127-RC
Protein status:IP18308.pep: gold
Sequenced Size:717

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34237 2008-04-29 Release 5.5 accounting
CG34237 2008-08-15 Release 5.9 accounting
CG34237 2008-12-18 5.12 accounting

Clone Sequence Records

IP18308.complete Sequence

717 bp assembled on 2007-01-15

GenBank Submission: BT030246

> IP18308.complete
AAACCATAGTGATTGGACAAGAAAAAGTTGAAGGTGATGAATGCTTTGAA
TGCTTTTGGAATGGCCATCGGCTGGATGGACATTGCGGGAGTTTTGTTCT
TCGAAATGATAATGTTCTATATGATGCGACGTCGTCGATTGGCACAAAAA
TCAGAAGTTGCATCGATTGAAGCACAAGAGAAGTGCCATAGAGATTCATT
GCCCAATCTCTTGACAAGGAAAAAGCTGAGTGAAAGCGAAAACATTTGGA
TATTCTGGGGCTACCTGTTGATGCTGAATATTTGGATTGGGGTCACTCTG
CTCATGATAGCTGGCATCTCATTTGTGGGTGAAAACAAAAACCGGAGCTT
ATGACATTATGGTTGATATGGTGCGCCTGTGGTTTGGTCTTCGATGTCTT
CCTCATTTTGTGGTGGGTCTACGAACTTTTTGTGGGCGACGCTATTGAGG
CACTGACCAACATTTTGATCTCCCTGCTGACCATGGCAATTGAGTTTGGC
TTCATCTATGTTATCTACACCATCTTCTTGAACTTGTCCAATGCCACGAA
AAATGAAGAGACCAAAGTGGCAGAAAAATCTAGATATCATTTTATGATGA
TTTCAGATCAGAAGAGATAAATTCAAATATGTTTGTGTTATATTCATAAA
TTTCATTTAAAAGTTTCAAAAATATTACGTCTATATTAATATCTCCATAA
AAAAAAAAAAAAAAAAA

IP18308.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42519-RA 698 CG42519-RA 1..698 1..698 3490 100 Plus
CG42520-RB 698 CG42520-RB 1..698 1..698 3490 100 Plus
CG42520-RA 760 CG42520-RA 268..760 206..698 2465 100 Plus
CG42520-RA 760 CG42520-RA 4..208 1..205 1025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10616787..10616991 205..1 1025 100 Minus
chr3L 24539361 chr3L 10616128..10616332 690..486 995 99 Minus
chr3L 24539361 chr3L 10616393..10616543 486..336 755 100 Minus
chr3L 24539361 chr3L 10616598..10616727 335..206 650 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:35:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10624727..10624940 699..486 1070 100 Minus
3L 28110227 3L 10625395..10625599 205..1 1025 100 Minus
3L 28110227 3L 10625001..10625151 486..336 755 100 Minus
3L 28110227 3L 10625206..10625335 335..206 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10617827..10618040 699..486 1070 100 Minus
3L 28103327 3L 10618495..10618699 205..1 1025 100 Minus
3L 28103327 3L 10618101..10618251 486..336 755 100 Minus
3L 28103327 3L 10618306..10618435 335..206 650 100 Minus
Blast to na_te.dros performed 2019-03-16 16:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1268..1319 622..674 109 69.8 Plus

IP18308.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:27:03 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10616598..10616727 206..335 100 <- Minus
chr3L 10616787..10616991 1..205 100   Minus
chr3L 10616119..10616331 487..698 98 <- Minus
chr3L 10616393..10616543 336..486 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:12:11 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG34237-RA 1..523 37..572 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:40 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RC 1..318 37..354 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:04 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RD 1..573 37..620 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:21 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG34237-RA 1..523 37..572 97   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:27:57 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RD 1..573 37..620 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:27 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG34237-RA 1..523 37..572 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:40 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RC 1..698 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:04 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RC 1..698 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:22 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG34237-RA 1..523 37..572 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:27:57 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
CG43127-RC 1..698 1..698 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:03 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10625001..10625151 336..486 100 <- Minus
3L 10625206..10625335 206..335 100 <- Minus
3L 10625395..10625599 1..205 100   Minus
3L 10624728..10624939 487..698 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:03 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10625001..10625151 336..486 100 <- Minus
3L 10625206..10625335 206..335 100 <- Minus
3L 10625395..10625599 1..205 100   Minus
3L 10624728..10624939 487..698 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:03 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10625001..10625151 336..486 100 <- Minus
3L 10625206..10625335 206..335 100 <- Minus
3L 10625395..10625599 1..205 100   Minus
3L 10624728..10624939 487..698 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:04 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10617828..10618039 487..698 100 <- Minus
arm_3L 10618101..10618251 336..486 100 <- Minus
arm_3L 10618306..10618435 206..335 100 <- Minus
arm_3L 10618495..10618699 1..205 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:26 Download gff for IP18308.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10618101..10618251 336..486 100 <- Minus
3L 10618306..10618435 206..335 100 <- Minus
3L 10618495..10618699 1..205 100   Minus
3L 10617828..10618039 487..698 100 <- Minus

IP18308.pep Sequence

Translation from 36 to 353

> IP18308.pep
MNALNAFGMAIGWMDIAGVLFFEMIMFYMMRRRRLAQKSEVASIEAQEKC
HRDSLPNLLTRKKLSESENIWIFWGYLLMLNIWIGVTLLMIAGISFVGEN
KNRSL*

IP18308.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23827-PA 334 GF23827-PA 2..66 1..69 189 58 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13970-PA 216 GG13970-PA 1..96 1..96 466 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16546-PA 102 GH16546-PA 2..99 1..97 131 37.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG43127-PC 105 CG42519-PA 1..105 1..105 542 100 Plus
CG43127-PD 190 CG43127-PD 1..96 1..96 497 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13836-PA 173 GI13836-PA 2..87 1..94 175 40.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23457-PA 503 GA23457-PA 2..101 1..96 229 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24806-PA 257 GM24806-PA 1..88 9..96 430 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12859-PA 250 GD12859-PA 1..96 1..96 481 94.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11702-PA 140 GJ11702-PA 2..86 1..94 175 42.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20269-PA 360 GE20269-PA 1..96 1..96 462 89.6 Plus

IP18308.hyp Sequence

Translation from 36 to 353

> IP18308.hyp
MNALNAFGMAIGWMDIAGVLFFEMIMFYMMRRRRLAQKSEVASIEAQEKC
HRDSLPNLLTRKKLSESENIWIFWGYLLMLNIWIGVTLLMIAGISFVGEN
KNRSL*

IP18308.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43127-PC 105 CG42519-PA 1..105 1..105 542 100 Plus
CG43127-PD 190 CG43127-PD 1..96 1..96 497 100 Plus