Clone IP18436 Report

Search the DGRC for IP18436

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:184
Well:36
Vector:pOT2
Associated Gene/TranscriptCG34323-RA
Protein status:IP18436.pep: gold
Sequenced Size:789

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34323 2008-04-29 Release 5.5 accounting
CG34323 2008-08-15 Release 5.9 accounting
CG34323 2008-12-18 5.12 accounting

Clone Sequence Records

IP18436.complete Sequence

789 bp assembled on 2007-01-15

GenBank Submission: BT030271

> IP18436.complete
AAGAAGAACATTTCGTTTCAAGTTTAAGAGTGTTATGTTTTGGTGGGAAA
AATGACATTCTATCTGGAACACGTGCTCACTGGCGATCGGATTAACTTGA
ACGAGGGCATCCAAATTCTGGGGCGCCACTCCTCTTGCACCTGGGTATTG
AAGTACGACTATATGTCGAGATATCATGCTCTTATTCACGTTAATCAGGG
AGACATTTTCATTAAGGAGATGGAAACCAATAATGGCATATTTCTTAACT
ATTGGCCGACGCGAATCGGCAGTTCTTGGTGCGAAGTAAACGTTGGCGAC
GTCCTGTACTTTGGGGTACAATTAGGCATCGAACACGATGGGGAGATACC
GAATACGTTCGGAATATTCACCGTTAAATCATCTGGATAAAACATCGGAG
AACTTTTCAGTTCCCATTAAACCGGGTGCTGAAATGCAAATGCCCCCATT
TAACGACACAATCCCTTTTTGGGGCGTTAATTTTCCAAGTCCGATCCTAA
GGATCCTGGATTCTGGATCCTAAGGACCAGAGTCATTGCTTACAAATCTA
CAAACCGACAATAACCACACACAGTGGCAGCTGAAAAAATACATAATAGG
GAACAACTTTAGATATTCAATCCAATCAACTATACAATACAATATTCAAT
ACAATCAACTAAGGGTATTTGCACATTTCCATATTCCAAATTGAAATATA
TATAGAGAAACAATGCAAGAAAATTGATCAAAAACATGAAATATCTAAGC
AAAATAAAACTTTTCTTTTCTGAAAAAAAAAAAAAAAAA

IP18436.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34323-RA 815 CG34323-RA 18..790 1..773 3865 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11961718..11962268 222..772 2755 100 Plus
chrX 22417052 chrX 11961442..11961664 1..223 1115 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:36:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12070713..12071264 222..773 2760 100 Plus
X 23542271 X 12070437..12070659 1..223 1115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12078811..12079362 222..773 2760 100 Plus
X 23527363 X 12078535..12078757 1..223 1115 100 Plus
Blast to na_te.dros performed 2019-03-16 18:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 690..788 584..683 147 63.7 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 680..814 617..743 133 60 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 1028..1060 419..451 129 87.9 Plus

IP18436.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:08:23 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11961442..11961663 1..222 100 -> Plus
chrX 11961719..11962268 223..772 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:12:43 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..339 52..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:47 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..339 52..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:07 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..339 52..390 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:07:44 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..339 52..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:44 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..339 52..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:28 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..339 52..390 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:47 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..772 1..772 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:07 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..772 1..772 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:07:44 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..339 52..390 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:44 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
CG34323-RA 1..772 1..772 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:23 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
X 12070437..12070658 1..222 100 -> Plus
X 12070714..12071263 223..772 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:23 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
X 12070437..12070658 1..222 100 -> Plus
X 12070714..12071263 223..772 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:08:23 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
X 12070437..12070658 1..222 100 -> Plus
X 12070714..12071263 223..772 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:07 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11964470..11964691 1..222 100 -> Plus
arm_X 11964747..11965296 223..772 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:39 Download gff for IP18436.complete
Subject Subject Range Query Range Percent Splice Strand
X 12078535..12078756 1..222 100 -> Plus
X 12078812..12079361 223..772 100   Plus

IP18436.pep Sequence

Translation from 51 to 389

> IP18436.pep
MTFYLEHVLTGDRINLNEGIQILGRHSSCTWVLKYDYMSRYHALIHVNQG
DIFIKEMETNNGIFLNYWPTRIGSSWCEVNVGDVLYFGVQLGIEHDGEIP
NTFGIFTVKSSG*

IP18436.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19383-PA 160 GF19383-PA 1..108 1..110 309 54.5 Plus
Dana\GF10480-PA 1728 GF10480-PA 3..93 2..90 156 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17709-PA 134 GG17709-PA 1..111 1..111 367 63.1 Plus
Dere\GG14918-PA 1681 GG14918-PA 5..70 3..66 140 40.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15286-PA 1706 GH15286-PA 8..113 3..109 165 34.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34323-PA 112 CG34323-PA 1..112 1..112 612 100 Plus
hog-PA 149 CG32595-PA 1..109 1..110 246 47.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11996-PA 1583 GI11996-PA 8..113 3..109 160 36.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23672-PA 1047 GL23672-PA 3..89 2..88 175 40.2 Plus
Dper\GL22478-PA 955 GL22478-PA 4..107 3..109 153 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26696-PA 1042 GA26696-PA 3..67 2..66 173 47.7 Plus
Dpse\GA20398-PA 1841 GA20398-PA 4..107 3..109 146 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13259-PA 116 GM13259-PA 1..110 1..110 464 77.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17065-PA 121 GD17065-PA 1..110 1..110 456 76.4 Plus
Dsim\GD15843-PA 168 GD15843-PA 1..110 1..111 221 43.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12221-PA 1858 GJ12221-PA 8..112 3..111 176 37.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19858-PA 1890 GK19858-PA 19..124 3..111 163 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16495-PA 137 GE16495-PA 1..110 1..110 392 64.5 Plus
Dyak\GE20371-PA 1699 GE20371-PA 5..111 3..109 144 36 Plus

IP18436.hyp Sequence

Translation from 51 to 389

> IP18436.hyp
MTFYLEHVLTGDRINLNEGIQILGRHSSCTWVLKYDYMSRYHALIHVNQG
DIFIKEMETNNGIFLNYWPTRIGSSWCEVNVGDVLYFGVQLGIEHDGEIP
NTFGIFTVKSSG*

IP18436.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34323-PA 112 CG34323-PA 1..112 1..112 612 100 Plus
hog-PA 149 CG32595-PA 1..109 1..110 246 47.3 Plus