BDGP Sequence Production Resources |
Search the DGRC for IP18521
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 185 |
Well: | 21 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34305-RA |
Protein status: | IP18521.pep: gold |
Sequenced Size: | 325 |
Gene | Date | Evidence |
---|---|---|
CG34305 | 2008-04-29 | Release 5.5 accounting |
CG34305 | 2008-08-15 | Release 5.9 accounting |
CG34305 | 2008-12-18 | 5.12 accounting |
325 bp assembled on 2007-01-15
GenBank Submission: BT030278
> IP18521.complete TTTCGACAAAATGAAGATACTCAACTTCATAATCCTGCTAGTCCTGGTGA CCATCGCTCTATCAGCCCCCGCTGCCGCCACAGACAATGCTCCTACGGTA TCCGTGCTGCGCTACAAAGATGATCGGGATTTGGCTAATATTCAGCGGGC AATTATTGCGCAGTACGAAAGAATTGGCGGCACCACTAAGGTTCATCAGC CACTGACGGCCAATATCGTCAACCCAGCAAGCCTTGGAATTGTCATTTAA TGCTCGTCAAAAATAAATTGTTTGTATTTGTGATTGTTAGCCCCGCTGAT AAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34305-RA | 360 | CG34305-RA | 61..360 | 1..300 | 1500 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 68507..68781 | 300..26 | 1375 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 4242783..4243059 | 302..26 | 1385 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 3983614..3983890 | 302..26 | 1385 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 68507..68781 | 26..300 | 100 | <- | Minus |
chr3R | 68844..68868 | 1..25 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..240 | 11..250 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..240 | 11..250 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..240 | 11..250 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..240 | 11..250 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..240 | 11..250 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..300 | 1..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..300 | 1..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..300 | 1..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..300 | 1..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34305-RA | 1..300 | 1..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 4242785..4243059 | 26..300 | 100 | <- | Minus |
3R | 4243122..4243146 | 1..25 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 4242785..4243059 | 26..300 | 100 | <- | Minus |
3R | 4243122..4243146 | 1..25 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 4242785..4243059 | 26..300 | 100 | <- | Minus |
3R | 4243122..4243146 | 1..25 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 68507..68781 | 26..300 | 100 | <- | Minus |
arm_3R | 68844..68868 | 1..25 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 3983616..3983890 | 26..300 | 100 | <- | Minus |
3R | 3983953..3983977 | 1..25 | 100 | Minus |
Translation from 0 to 249
> IP18521.hyp FDKMKILNFIILLVLVTIALSAPAAATDNAPTVSVLRYKDDRDLANIQRA IIAQYERIGGTTKVHQPLTANIVNPASLGIVI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34305-PA | 79 | CG34305-PA | 1..79 | 4..82 | 382 | 100 | Plus |
Translation from 1 to 249
> IP18521.pep FDKMKILNFIILLVLVTIALSAPAAATDNAPTVSVLRYKDDRDLANIQRA IIAQYERIGGTTKVHQPLTANIVNPASLGIVI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16824-PA | 81 | GF16824-PA | 4..79 | 9..80 | 209 | 59.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21855-PA | 82 | GH21855-PA | 1..82 | 4..82 | 187 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34305-PA | 79 | CG34305-PA | 1..79 | 4..82 | 382 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21933-PA | 81 | GI21933-PA | 27..81 | 29..82 | 177 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12335-PA | 84 | GL12335-PA | 31..84 | 29..82 | 185 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27470-PB | 100 | GA27470-PB | 47..100 | 29..82 | 188 | 66.7 | Plus |
Dpse\GA27470-PA | 84 | GA27470-PA | 1..84 | 4..82 | 187 | 51.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10720-PA | 79 | GM10720-PA | 18..79 | 21..82 | 303 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19695-PA | 464 | GD19695-PA | 18..69 | 21..72 | 262 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14292-PA | 82 | GJ14292-PA | 27..82 | 28..82 | 187 | 62.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22651-PA | 80 | GK22651-PA | 1..80 | 4..82 | 170 | 46.9 | Plus |