Clone IP18521 Report

Search the DGRC for IP18521

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:185
Well:21
Vector:pOT2
Associated Gene/TranscriptCG34305-RA
Protein status:IP18521.pep: gold
Sequenced Size:325

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34305 2008-04-29 Release 5.5 accounting
CG34305 2008-08-15 Release 5.9 accounting
CG34305 2008-12-18 5.12 accounting

Clone Sequence Records

IP18521.complete Sequence

325 bp assembled on 2007-01-15

GenBank Submission: BT030278

> IP18521.complete
TTTCGACAAAATGAAGATACTCAACTTCATAATCCTGCTAGTCCTGGTGA
CCATCGCTCTATCAGCCCCCGCTGCCGCCACAGACAATGCTCCTACGGTA
TCCGTGCTGCGCTACAAAGATGATCGGGATTTGGCTAATATTCAGCGGGC
AATTATTGCGCAGTACGAAAGAATTGGCGGCACCACTAAGGTTCATCAGC
CACTGACGGCCAATATCGTCAACCCAGCAAGCCTTGGAATTGTCATTTAA
TGCTCGTCAAAAATAAATTGTTTGTATTTGTGATTGTTAGCCCCGCTGAT
AAAAAAAAAAAAAAAAAAAAAAAAA

IP18521.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34305-RA 360 CG34305-RA 61..360 1..300 1500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 68507..68781 300..26 1375 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:36:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4242783..4243059 302..26 1385 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 3983614..3983890 302..26 1385 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:56:59 has no hits.

IP18521.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:57:43 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 68507..68781 26..300 100 <- Minus
chr3R 68844..68868 1..25 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:12:52 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..240 11..250 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:11:03 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..240 11..250 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:47:03 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..240 11..250 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:21:12 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..240 11..250 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:52 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..240 11..250 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:40:02 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..300 1..300 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:11:03 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..300 1..300 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:47:03 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..300 1..300 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:21:12 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..300 1..300 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:52 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34305-RA 1..300 1..300 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:43 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4242785..4243059 26..300 100 <- Minus
3R 4243122..4243146 1..25 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:43 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4242785..4243059 26..300 100 <- Minus
3R 4243122..4243146 1..25 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:57:43 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4242785..4243059 26..300 100 <- Minus
3R 4243122..4243146 1..25 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:03 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 68507..68781 26..300 100 <- Minus
arm_3R 68844..68868 1..25 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:43:02 Download gff for IP18521.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3983616..3983890 26..300 100 <- Minus
3R 3983953..3983977 1..25 100   Minus

IP18521.hyp Sequence

Translation from 0 to 249

> IP18521.hyp
FDKMKILNFIILLVLVTIALSAPAAATDNAPTVSVLRYKDDRDLANIQRA
IIAQYERIGGTTKVHQPLTANIVNPASLGIVI*

IP18521.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG34305-PA 79 CG34305-PA 1..79 4..82 382 100 Plus

IP18521.pep Sequence

Translation from 1 to 249

> IP18521.pep
FDKMKILNFIILLVLVTIALSAPAAATDNAPTVSVLRYKDDRDLANIQRA
IIAQYERIGGTTKVHQPLTANIVNPASLGIVI*

IP18521.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16824-PA 81 GF16824-PA 4..79 9..80 209 59.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21855-PA 82 GH21855-PA 1..82 4..82 187 54.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG34305-PA 79 CG34305-PA 1..79 4..82 382 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21933-PA 81 GI21933-PA 27..81 29..82 177 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12335-PA 84 GL12335-PA 31..84 29..82 185 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27470-PB 100 GA27470-PB 47..100 29..82 188 66.7 Plus
Dpse\GA27470-PA 84 GA27470-PA 1..84 4..82 187 51.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10720-PA 79 GM10720-PA 18..79 21..82 303 95.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19695-PA 464 GD19695-PA 18..69 21..72 262 94.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14292-PA 82 GJ14292-PA 27..82 28..82 187 62.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22651-PA 80 GK22651-PA 1..80 4..82 170 46.9 Plus