Clone IP18534 Report

Search the DGRC for IP18534

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:185
Well:34
Vector:pOT2
Associated Gene/TranscriptinaF-C-RA
Protein status:IP18534.pep: gold
Sequenced Size:698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34321 2008-04-29 Release 5.5 accounting
inaF 2008-08-15 Release 5.9 accounting
CG34321 2008-12-18 5.12 accounting
CG34322 2008-12-18 5.12 accounting
CG42447 2008-12-18 5.12 accounting
inaF 2008-12-18 5.12 accounting

Clone Sequence Records

IP18534.complete Sequence

698 bp assembled on 2007-01-29

GenBank Submission: BT030281

> IP18534.complete
GTGGGTGGAATATGGCGTCATTCGTGTGATTTTGATTTAATCGTGGTAGC
GATTCCAAATCAGTAGCTGCCACATCGCGAACTGGACGGACGCGACCAGA
AAAGTACATATCCGCAGTAATGTCCACTGCGTCAGAATCCGCCAGGGCGG
GCCTGGGCAATGCCGCCAGCATGGCGAATCTTGCCAAGATTGTCAATCTC
ATCGAATCGAACGTGAAGAGCGAGGATGTGGAGGTGCTTGAGGAAGCGGT
CAGGGGATCAACCGGAACCGGAAGTGGCAGCAGCGTCCGCTTGGCCAGCA
GCAGTGCCCCGCGTAGAAGTGCCTGTGCCACATCGTATGTCCCCAAGTCA
CCGCAGCTGGAGGAGATTGTGTTCGCAGAGCCCACGTATACCGAGCGATT
TGCCCGATACTTTGTGATCGTGATCTATTTGTGCGGGCTCTGCAGCCTGG
GATTCTTTCTGTCCATCTACCACATCTTCTTCTGGGATTCACGCATGCCA
CCCGTTTACAAGGGCCAGAAGAAGGGGCCTGCCTTCGGCTAGAGCTGCCT
GGTTAACACATCCACTTCATTCACCGAAATATTTCCCAACTTAGTGAAAT
TTCATTTGATTTTTGATAAAATTGTGATACCCGAGAAAATAGCCATTCGC
CTCCTGAACTCATCGGAAGTGACCGCGGAGCAGTTCTACAAGCACATC

IP18534.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
inaF-C.a 3306 inaF-C.a 1..698 1..698 3490 100 Plus
inaF-C-RA 1590 inaF-C-RA 1..698 1..698 3490 100 Plus
inaF-A-RA 1274 inaF-A-RA 298..382 614..698 425 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11622364..11622982 619..1 3065 99.7 Minus
chrX 22417052 chrX 11618501..11618584 698..615 420 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:36:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11731147..11731765 619..1 3080 99.8 Minus
X 23542271 X 11727282..11727365 698..615 420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11739245..11739863 619..1 3080 99.8 Minus
X 23527363 X 11735380..11735463 698..615 420 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:41:00 has no hits.

IP18534.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:08 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11618501..11618583 616..698 100 <- Minus
chrX 11622368..11622982 1..615 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:12:55 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
CG34321-RA 1..423 120..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:08:37 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
inaF-C-RA 1..423 120..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:57 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
inaF-C-RA 1..423 120..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:18:56 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
CG34321-RA 1..423 120..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:08:56 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
inaF-C-RA 1..423 120..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:37:36 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
CG34321-RA 1..698 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:08:37 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
inaF-C-RA 1..698 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:57 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
inaF-C-RA 1..698 1..698 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:18:56 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
CG34321-RA 1..423 120..542 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:08:56 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
inaF-C-RA 1..698 1..698 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:08 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11727282..11727364 616..698 100 <- Minus
X 11731151..11731765 1..615 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:08 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11727282..11727364 616..698 100 <- Minus
X 11731151..11731765 1..615 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:08 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11727282..11727364 616..698 100 <- Minus
X 11731151..11731765 1..615 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:57 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11621315..11621397 616..698 100 <- Minus
arm_X 11625184..11625798 1..615 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:41:24 Download gff for IP18534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11735380..11735462 616..698 100 <- Minus
X 11739249..11739863 1..615 100   Minus

IP18534.pep Sequence

Translation from 119 to 541

> IP18534.pep
MSTASESARAGLGNAASMANLAKIVNLIESNVKSEDVEVLEEAVRGSTGT
GSGSSVRLASSSAPRRSACATSYVPKSPQLEEIVFAEPTYTERFARYFVI
VIYLCGLCSLGFFLSIYHIFFWDSRMPPVYKGQKKGPAFG*

IP18534.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20256-PA 136 GF20256-PA 12..136 13..140 462 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18837-PA 140 GG18837-PA 1..140 1..140 582 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24592-PA 125 GH24592-PA 8..125 14..140 436 67.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
inaF-C-PA 140 CG34321-PA 1..140 1..140 710 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15262-PA 133 GI15262-PA 9..133 19..140 427 67.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15231-PA 142 GL15231-PA 18..142 11..140 509 77.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22924-PA 150 GA22924-PA 20..150 5..140 522 76.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13050-PA 140 GM13050-PA 1..140 1..140 709 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15975-PA 142 GD15975-PA 1..142 1..140 695 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14835-PA 110 GJ14835-PA 20..110 48..140 386 79.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16287-PA 133 GK16287-PA 15..133 13..140 483 72.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17602-PA 142 GE17602-PA 1..142 1..140 541 89.4 Plus

IP18534.hyp Sequence

Translation from 119 to 541

> IP18534.hyp
MSTASESARAGLGNAASMANLAKIVNLIESNVKSEDVEVLEEAVRGSTGT
GSGSSVRLASSSAPRRSACATSYVPKSPQLEEIVFAEPTYTERFARYFVI
VIYLCGLCSLGFFLSIYHIFFWDSRMPPVYKGQKKGPAFG*

IP18534.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
inaF-C-PA 140 CG34321-PA 1..140 1..140 710 100 Plus