BDGP Sequence Production Resources |
Search the DGRC for IP18555
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 185 |
Well: | 55 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34337-RA |
Protein status: | IP18555.pep: gold |
Sequenced Size: | 370 |
Gene | Date | Evidence |
---|---|---|
CG34337 | 2008-04-29 | Release 5.5 accounting |
CG34337 | 2008-08-15 | Release 5.9 accounting |
CG34337 | 2008-12-18 | 5.12 accounting |
370 bp assembled on 2007-01-15
GenBank Submission: BT030287
> IP18555.complete ATGGAATACAGTATTTTCATTTTTCTGGCCCTGACTTGTGTCCTATTTAT GGGTCAGAGCTGCTTGGCGGCTCCCTCGGCCGATGATTTGGCCAAATTTG GTGAAATGGAACGTTCCATCAAGGAGCTGACCAGTTCGATCCTGGCCATG AGTGGAGCTACTACCGGCTTTAGACCCGGGGCTAATAATGTTTGGCCTGA AGATCTTCATGCTTAAGTTTTGGCCAAAAATCCGTCAGCTCGGTCTACTA AATCGTGTTTAGCAGTTCTGCAGTTTAATATTTTGCAATACTATTTTTTT TTCTTTTGGATAATAAAATATTAGGCACAACTTATGCGTACTTGCATACA TTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34337-RA | 395 | CG34337-RA | 31..382 | 1..352 | 1760 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
invader3 | 5484 | invader3 INVADER3 5484bp | 3483..3560 | 333..256 | 128 | 65.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 7309203..7309368 | 1..166 | 100 | -> | Plus |
chrX | 7309439..7309624 | 167..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 1..216 | 1..216 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 1..216 | 1..216 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 1..216 | 1..216 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 1..216 | 1..216 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 1..216 | 1..216 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 1..216 | 1..216 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 20..371 | 1..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 20..371 | 1..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 1..216 | 1..216 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34337-RA | 20..371 | 1..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7417272..7417437 | 1..166 | 100 | -> | Plus |
X | 7417508..7417693 | 167..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7417272..7417437 | 1..166 | 100 | -> | Plus |
X | 7417508..7417693 | 167..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7417272..7417437 | 1..166 | 100 | -> | Plus |
X | 7417508..7417693 | 167..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 7311305..7311470 | 1..166 | 100 | -> | Plus |
arm_X | 7311541..7311726 | 167..352 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7425370..7425535 | 1..166 | 100 | -> | Plus |
X | 7425606..7425791 | 167..352 | 100 | Plus |
Translation from 0 to 215
> IP18555.pep MEYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAM SGATTGFRPGANNVWPEDLHA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21147-PA | 74 | GF21147-PA | 1..74 | 1..71 | 201 | 56.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19646-PA | 83 | GG19646-PA | 12..83 | 1..71 | 263 | 72.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34337-PA | 71 | CG34337-PA | 1..71 | 1..71 | 365 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14704-PA | 159 | GL14704-PA | 102..138 | 20..56 | 130 | 70.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23783-PA | 84 | GA23783-PA | 1..81 | 1..68 | 168 | 49.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17524-PA | 71 | GM17524-PA | 1..71 | 1..71 | 334 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16845-PA | 71 | GD16845-PA | 1..71 | 1..71 | 349 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15720-PA | 71 | GE15720-PA | 1..71 | 1..71 | 246 | 77.5 | Plus |
Translation from 1 to 215
> IP18555.hyp MEYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAM SGATTGFRPGANNVWPEDLHA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34337-PA | 71 | CG34337-PA | 1..71 | 1..71 | 365 | 100 | Plus |