Clone IP18555 Report

Search the DGRC for IP18555

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:185
Well:55
Vector:pOT2
Associated Gene/TranscriptCG34337-RA
Protein status:IP18555.pep: gold
Sequenced Size:370

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34337 2008-04-29 Release 5.5 accounting
CG34337 2008-08-15 Release 5.9 accounting
CG34337 2008-12-18 5.12 accounting

Clone Sequence Records

IP18555.complete Sequence

370 bp assembled on 2007-01-15

GenBank Submission: BT030287

> IP18555.complete
ATGGAATACAGTATTTTCATTTTTCTGGCCCTGACTTGTGTCCTATTTAT
GGGTCAGAGCTGCTTGGCGGCTCCCTCGGCCGATGATTTGGCCAAATTTG
GTGAAATGGAACGTTCCATCAAGGAGCTGACCAGTTCGATCCTGGCCATG
AGTGGAGCTACTACCGGCTTTAGACCCGGGGCTAATAATGTTTGGCCTGA
AGATCTTCATGCTTAAGTTTTGGCCAAAAATCCGTCAGCTCGGTCTACTA
AATCGTGTTTAGCAGTTCTGCAGTTTAATATTTTGCAATACTATTTTTTT
TTCTTTTGGATAATAAAATATTAGGCACAACTTATGCGTACTTGCATACA
TTAAAAAAAAAAAAAAAAAA

IP18555.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34337-RA 395 CG34337-RA 31..382 1..352 1760 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7309438..7309624 166..352 935 100 Plus
chrX 22417052 chrX 7309203..7309369 1..167 835 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:36:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7417507..7417693 166..352 935 100 Plus
X 23542271 X 7417272..7417438 1..167 835 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7425605..7425791 166..352 935 100 Plus
X 23527363 X 7425370..7425536 1..167 835 100 Plus
Blast to na_te.dros performed 2019-03-16 09:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 3483..3560 333..256 128 65.8 Minus

IP18555.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:56:00 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7309203..7309368 1..166 100 -> Plus
chrX 7309439..7309624 167..352 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:13:00 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 1..216 1..216 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:36:56 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 1..216 1..216 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:54:23 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 1..216 1..216 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:13:33 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 1..216 1..216 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:48:57 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 1..216 1..216 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:41:10 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 1..216 1..216 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:36:56 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 20..371 1..352 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:54:23 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 20..371 1..352 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:13:33 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 1..216 1..216 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:48:57 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34337-RA 20..371 1..352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:00 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
X 7417272..7417437 1..166 100 -> Plus
X 7417508..7417693 167..352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:00 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
X 7417272..7417437 1..166 100 -> Plus
X 7417508..7417693 167..352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:00 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
X 7417272..7417437 1..166 100 -> Plus
X 7417508..7417693 167..352 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:54:23 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7311305..7311470 1..166 100 -> Plus
arm_X 7311541..7311726 167..352 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:49:27 Download gff for IP18555.complete
Subject Subject Range Query Range Percent Splice Strand
X 7425370..7425535 1..166 100 -> Plus
X 7425606..7425791 167..352 100   Plus

IP18555.pep Sequence

Translation from 0 to 215

> IP18555.pep
MEYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAM
SGATTGFRPGANNVWPEDLHA*

IP18555.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21147-PA 74 GF21147-PA 1..74 1..71 201 56.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19646-PA 83 GG19646-PA 12..83 1..71 263 72.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34337-PA 71 CG34337-PA 1..71 1..71 365 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14704-PA 159 GL14704-PA 102..138 20..56 130 70.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23783-PA 84 GA23783-PA 1..81 1..68 168 49.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17524-PA 71 GM17524-PA 1..71 1..71 334 88.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16845-PA 71 GD16845-PA 1..71 1..71 349 91.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15720-PA 71 GE15720-PA 1..71 1..71 246 77.5 Plus

IP18555.hyp Sequence

Translation from 1 to 215

> IP18555.hyp
MEYSIFIFLALTCVLFMGQSCLAAPSADDLAKFGEMERSIKELTSSILAM
SGATTGFRPGANNVWPEDLHA*

IP18555.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34337-PA 71 CG34337-PA 1..71 1..71 365 100 Plus