IP18626.complete Sequence
372 bp assembled on 2007-01-15
GenBank Submission: BT030291
> IP18626.complete
CTAACGCAGTGTTAGGAGCCACAAAAATGGGACACATGCAGGACAGGATT
AAGGACTTGATCACCGCTGAGCGCGTGGCTATATTCTTTGGTCTATTATC
GACCTGCTTGATCGTTGCCCTTGTCATTGTGGCCGTCCACAGGGATAATT
TATTGCTGCAGTTGGACGAAGCCAAAAGGATGTTGGATGTTCTGGAGGAA
TACATTCAAAGCCACTTGTTGTCCACCATTTCGGAAAGAAATTCATAAGA
ATTAGGGTGCTGGCAAACATTCAAAAAGATGGCTTTCAAATCCATATCTA
TTTCCAAAAATGGTTAAAGCAATAAAGCAATAAAGGCAAACGGATAAGAA
ACCAAAAAAAAAAAAAAAAAAA
IP18626.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:08:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MB6.chr3R.pasa.10072.a | 353 | MB6.chr3R.pasa.10072.a | 1..353 | 1..353 | 1765 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:56:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 9128721..9129020 | 54..353 | 1485 | 99.7 | Plus |
chr3R | 27901430 | chr3R | 9128603..9128656 | 1..54 | 270 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:37:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:56:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13303557..13303860 | 54..357 | 1520 | 100 | Plus |
3R | 32079331 | 3R | 13303439..13303492 | 1..54 | 270 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 13044388..13044691 | 54..357 | 1520 | 100 | Plus |
3R | 31820162 | 3R | 13044270..13044323 | 1..54 | 270 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 21:56:37 has no hits.
IP18626.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:57:36 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 9128603..9128656 | 1..54 | 100 | -> | Plus |
chr3R | 9128722..9129020 | 55..353 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:02:11 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 1..222 | 27..248 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:21:07 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:19 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 1..222 | 27..248 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:02:11 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 14..366 | 1..353 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:21:07 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mid-RA | 2338..2356 | 266..284 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:19 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 14..366 | 1..353 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:36 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13303439..13303492 | 1..54 | 100 | -> | Plus |
3R | 13303558..13303856 | 55..353 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:36 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13303439..13303492 | 1..54 | 100 | -> | Plus |
3R | 13303558..13303856 | 55..353 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:36 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13303439..13303492 | 1..54 | 100 | -> | Plus |
3R | 13303558..13303856 | 55..353 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:02:11 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9129161..9129214 | 1..54 | 100 | -> | Plus |
arm_3R | 9129280..9129578 | 55..353 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:42:58 Download gff for
IP18626.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13044270..13044323 | 1..54 | 100 | -> | Plus |
3R | 13044389..13044687 | 55..353 | 100 | | Plus |
IP18626.pep Sequence
Translation from 2 to 247
> IP18626.pep
NAVLGATKMGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNL
LLQLDEAKRMLDVLEEYIQSHLLSTISERNS*
IP18626.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-PA | 73 | CG43208-PA | 1..73 | 9..81 | 355 | 100 | Plus |
IP18626.hyp Sequence
Translation from 2 to 247
> IP18626.hyp
NAVLGATKMGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNL
LLQLDEAKRMLDVLEEYIQSHLLSTISERNS*
IP18626.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:49:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-PA | 73 | CG43208-PA | 1..73 | 9..81 | 355 | 100 | Plus |