Clone IP18626 Report

Search the DGRC for IP18626

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:186
Well:26
Vector:pOT2
Associated Gene/TranscriptCG43208-RA
Protein status:IP18626.pep: gold
Sequenced Size:372

Clone Sequence Records

IP18626.complete Sequence

372 bp assembled on 2007-01-15

GenBank Submission: BT030291

> IP18626.complete
CTAACGCAGTGTTAGGAGCCACAAAAATGGGACACATGCAGGACAGGATT
AAGGACTTGATCACCGCTGAGCGCGTGGCTATATTCTTTGGTCTATTATC
GACCTGCTTGATCGTTGCCCTTGTCATTGTGGCCGTCCACAGGGATAATT
TATTGCTGCAGTTGGACGAAGCCAAAAGGATGTTGGATGTTCTGGAGGAA
TACATTCAAAGCCACTTGTTGTCCACCATTTCGGAAAGAAATTCATAAGA
ATTAGGGTGCTGGCAAACATTCAAAAAGATGGCTTTCAAATCCATATCTA
TTTCCAAAAATGGTTAAAGCAATAAAGCAATAAAGGCAAACGGATAAGAA
ACCAAAAAAAAAAAAAAAAAAA

IP18626.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
MB6.chr3R.pasa.10072.a 353 MB6.chr3R.pasa.10072.a 1..353 1..353 1765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9128721..9129020 54..353 1485 99.7 Plus
chr3R 27901430 chr3R 9128603..9128656 1..54 270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:37:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13303557..13303860 54..357 1520 100 Plus
3R 32079331 3R 13303439..13303492 1..54 270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13044388..13044691 54..357 1520 100 Plus
3R 31820162 3R 13044270..13044323 1..54 270 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:56:37 has no hits.

IP18626.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:57:36 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9128603..9128656 1..54 100 -> Plus
chr3R 9128722..9129020 55..353 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:02:11 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 1..222 27..248 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:21:07 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:19 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 1..222 27..248 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:02:11 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 14..366 1..353 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:21:07 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
mid-RA 2338..2356 266..284 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:19 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 14..366 1..353 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:36 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13303439..13303492 1..54 100 -> Plus
3R 13303558..13303856 55..353 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:36 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13303439..13303492 1..54 100 -> Plus
3R 13303558..13303856 55..353 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:36 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13303439..13303492 1..54 100 -> Plus
3R 13303558..13303856 55..353 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:02:11 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9129161..9129214 1..54 100 -> Plus
arm_3R 9129280..9129578 55..353 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:42:58 Download gff for IP18626.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13044270..13044323 1..54 100 -> Plus
3R 13044389..13044687 55..353 100   Plus

IP18626.pep Sequence

Translation from 2 to 247

> IP18626.pep
NAVLGATKMGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNL
LLQLDEAKRMLDVLEEYIQSHLLSTISERNS*

IP18626.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-PA 73 CG43208-PA 1..73 9..81 355 100 Plus

IP18626.hyp Sequence

Translation from 2 to 247

> IP18626.hyp
NAVLGATKMGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNL
LLQLDEAKRMLDVLEEYIQSHLLSTISERNS*

IP18626.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-PA 73 CG43208-PA 1..73 9..81 355 100 Plus