Clone IP18705 Report

Search the DGRC for IP18705

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:187
Well:5
Vector:pOT2
Associated Gene/TranscriptCG34300-RB
Protein status:IP18705.pep: gold
Sequenced Size:655

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34300 2008-04-29 Release 5.5 accounting
CG34300 2008-08-15 Release 5.9 accounting
CG34300 2008-12-18 5.12 accounting

Clone Sequence Records

IP18705.complete Sequence

655 bp assembled on 2007-01-15

GenBank Submission: BT030296

> IP18705.complete
AAATGTCGGGGAACCTGGCTCAAATCCTGTTGCTGCTGTGTGAATCTGCG
GGCGGGATGCTTTTTCATGGCGCTTTTCGAGATTTTCGCATCGATCCTGG
GGTTCTTTGTTGGCGAAGGTAAGCAGAGATGGTCGTCTGTTAGTAATTAG
CAGAGCTGCCTATATGGTGCACTTTTTTGGATCGATTTTTCTGATGATGA
GCAGTATCTTGATCGAATTTCTGGTGATCATCTATCTGGTAACAGATATA
ATCCACCTGATCTTTTGTAGCCCCTTTATAATCAATTATGCGTTAAGTTG
TAGCTTCTGCACTCTAGAATCGATTCCTGTATTCTTCACCCTAGCTTTTA
GCCTTTATTTTTGGATAGTGGCATTTTTCTACTGGCGACGCCTTCTCTGG
GAACACAATCCCGAAAACGACGACTGAGGCGAAGGGGTATCGTTAATTCT
GGATCTTGAGTGTTTATTCTGCGCTCTTGTGTTGGTTTTTGCGCTATGTA
CGCTATTTTCTGTTTTGGCCCTAATTTCACACTAATTTGTAAATTTGCCT
TTAATGCCAAAGACAAAGAGAAAAACGAAAAGAGCAAAGTTCCGCAAATT
GTTTGTACAGAGAAATATATTTTGTATTCATCACTAAAAAAAAAAAAAAA
AAAAA

IP18705.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34300.a 861 CG34300.a 182..817 1..636 3180 100 Plus
CG34300.b 803 CG34300.b 282..794 127..636 2495 99.4 Plus
CG34300.b 803 CG34300.b 166..283 1..118 590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26128296..26128588 635..343 1465 100 Minus
chr3R 27901430 chr3R 26128647..26128780 344..211 655 99.3 Minus
chr3R 27901430 chr3R 26128998..26129125 128..1 610 98.4 Minus
chr3R 27901430 chr3R 26128836..26128920 211..127 395 97.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:37:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30305807..30306100 636..343 1470 100 Minus
3R 32079331 3R 30306159..30306292 344..211 670 100 Minus
3R 32079331 3R 30306510..30306637 128..1 640 100 Minus
3R 32079331 3R 30306348..30306432 211..127 425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30046638..30046931 636..343 1470 100 Minus
3R 31820162 3R 30046990..30047123 344..211 670 100 Minus
3R 31820162 3R 30047341..30047468 128..1 640 100 Minus
3R 31820162 3R 30047179..30047263 211..127 425 100 Minus
Blast to na_te.dros performed 2019-03-16 03:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
springer 7546 springer SPRINGER 7546bp Derived from BACR06P08 by Sue Celniker, 29 March 2001. 809..842 591..558 107 79.4 Minus

IP18705.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:59:16 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26128998..26129125 1..128 98   Minus
chr3R 26128296..26128586 345..635 100 <- Minus
chr3R 26128647..26128779 212..344 99 <- Minus
chr3R 26128836..26128918 129..211 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:13:13 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RA 4..423 1..427 96   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:59 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RA 4..423 1..427 96   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:52 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RA 4..423 1..427 96   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:08 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RA 4..423 1..427 96   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:20:36 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RA 4..423 1..427 96   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:42 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RA 4..423 1..427 96   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:59 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RB 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:52 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RB 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:10 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RA 4..423 1..427 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:20:36 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
CG34300-RB 1..635 1..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:16 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30305808..30306098 345..635 100 <- Minus
3R 30306159..30306291 212..344 100 <- Minus
3R 30306348..30306430 129..211 100 <- Minus
3R 30306510..30306637 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:16 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30305808..30306098 345..635 100 <- Minus
3R 30306159..30306291 212..344 100 <- Minus
3R 30306348..30306430 129..211 100 <- Minus
3R 30306510..30306637 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:59:16 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30305808..30306098 345..635 100 <- Minus
3R 30306159..30306291 212..344 100 <- Minus
3R 30306348..30306430 129..211 100 <- Minus
3R 30306510..30306637 1..128 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:52 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26131530..26131820 345..635 100 <- Minus
arm_3R 26131881..26132013 212..344 100 <- Minus
arm_3R 26132070..26132152 129..211 100 <- Minus
arm_3R 26132232..26132359 1..128 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:08 Download gff for IP18705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30046639..30046929 345..635 100 <- Minus
3R 30046990..30047122 212..344 100 <- Minus
3R 30047179..30047261 129..211 100 <- Minus
3R 30047341..30047468 1..128 100   Minus

IP18705.pep Sequence

Translation from 163 to 426

> IP18705.pep
MVHFFGSIFLMMSSILIEFLVIIYLVTDIIHLIFCSPFIINYALSCSFCT
LESIPVFFTLAFSLYFWIVAFFYWRRLLWEHNPENDD*

IP18705.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16186-PA 97 GF16186-PA 46..97 36..87 169 57.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34300-PB 87 CG34300-PB 1..87 1..87 469 100 Plus
CG34300-PA 140 CG34300-PA 53..140 1..87 457 98.9 Plus

IP18705.hyp Sequence

Translation from 163 to 426

> IP18705.hyp
MVHFFGSIFLMMSSILIEFLVIIYLVTDIIHLIFCSPFIINYALSCSFCT
LESIPVFFTLAFSLYFWIVAFFYWRRLLWEHNPENDD*

IP18705.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34300-PB 87 CG34300-PB 1..87 1..87 469 100 Plus
CG34300-PA 140 CG34300-PA 53..140 1..87 457 98.9 Plus