Clone IP19016 Report

Search the DGRC for IP19016

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:190
Well:16
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG14187-RA
Protein status:IP19016.pep: gold
Sequenced Size:522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14187 2008-04-29 Release 5.5 accounting
CG14187 2008-05-05 Release 5.5 slip selected
CG14187 2008-08-15 Release 5.9 accounting
CG14187 2008-12-18 5.12 accounting

Clone Sequence Records

IP19016.complete Sequence

522 bp assembled on 2007-08-02

GenBank Submission: BT030860

> IP19016.complete
ACATTTGCGCAAATTTCTAGCCATGGGAGACGACAACCAGCGATTCCAAT
TCCAACTGCAGGCAGTGGCAACAGTTTTCTTGTTGGTTTCACAGCTTTGC
TTTGCCCTGCCCTTTGCATCTTCCACCGGAAACGATATAGAAAACGATGG
GAACATTCAGAATTCGGCCAGTGGACGACCTGTGGATTATCACACGGTGG
TGGGCCACTTCAAGGACTTCTTCATGTACCTGCCGGTGATGATGACCACG
CTGAAGGAGACGATGTCAGGATTCCCCAAGTTCGCCGAGGGCATGCGCAT
CCTGACTTCTGGCAAAGGACGAGTGGACGGCGAGGATTGCAAGTGCAGCC
AAAATGCATTGGCCAGCGGCGAACTCTTGGACACCAATTCTCGCTTCGGT
TGACCCAGTCTAATGTATGTAATTGCCCACGATCGCAGATACTTTACATG
ATGCGCACATGACAAATAAAGACAACAGAACTACATGAGAATTAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

IP19016.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14187-RA 523 CG14187-RA 1..500 1..500 2470 99.6 Plus
CG14187.a 469 CG14187.a 86..446 140..500 1775 99.4 Plus
CG14187.a 469 CG14187.a 1..86 1..86 430 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20101543..20101949 492..86 2020 99.8 Minus
chr3L 24539361 chr3L 20102040..20102125 86..1 415 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:37:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20112257..20112671 500..86 2045 99.5 Minus
3L 28110227 3L 20112762..20112847 86..1 430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20105357..20105771 500..86 2045 99.5 Minus
3L 28103327 3L 20105862..20105947 86..1 430 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:18:28 has no hits.

IP19016.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:19:07 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20101542..20101948 87..493 99 <- Minus
chr3L 20102040..20102125 1..86 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:13:41 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..381 23..403 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:42 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..381 23..403 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:37 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..381 23..403 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:09:49 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..381 23..403 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:38:11 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..381 23..403 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:43 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..381 23..403 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:42 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..492 1..492 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:37 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..492 1..492 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:09:50 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..381 23..403 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:38:11 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 1..492 1..492 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:19:07 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20112264..20112670 87..493 99 <- Minus
3L 20112762..20112847 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:19:07 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20112264..20112670 87..493 99 <- Minus
3L 20112762..20112847 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:19:07 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20112264..20112670 87..493 99 <- Minus
3L 20112762..20112847 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:37 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20105364..20105770 87..493 99 <- Minus
arm_3L 20105862..20105947 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:57:51 Download gff for IP19016.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20105364..20105770 87..493 99 <- Minus
3L 20105862..20105947 1..86 100   Minus

IP19016.hyp Sequence

Translation from 0 to 461

> IP19016.hyp
TFAQISSHGRRQPAIPIPTAGSGNSFLVGFTALLCPALCIFHRKRYRKRW
EHSEFGQWTTCGLSHGGGPLQGLLHVPAGDDDHAEGDDVRIPQVRRGHAH
PDFWQRTSGRRGLQVQPKCIGQRRTLGHQFSLRLTQSNVCNCPRSQILYM
MRT*
Sequence IP19016.hyp has no blast hits.

IP19016.pep Sequence

Translation from 1 to 402

> IP19016.pep
HLRKFLAMGDDNQRFQFQLQAVATVFLLVSQLCFALPFASSTGNDIENDG
NIQNSASGRPVDYHTVVGHFKDFFMYLPVMMTTLKETMSGFPKFAEGMRI
LTSGKGRVDGEDCKCSQNALASGELLDTNSRFG*

IP19016.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25211-PA 118 GF25211-PA 9..118 20..133 472 77.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13345-PA 126 GG13345-PA 1..126 8..133 614 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16352-PA 129 GH16352-PA 3..128 11..132 442 69.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG14187-PA 126 CG14187-PA 1..126 8..133 659 100 Plus
CG14187-PB 108 CG14187-PB 1..108 8..133 538 85.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11545-PA 127 GI11545-PA 21..127 33..133 411 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24839-PA 439 GL24839-PA 330..439 29..133 408 73.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12815-PA 128 GA12815-PA 4..128 10..133 454 70.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22251-PA 126 GM22251-PA 1..126 8..133 667 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12223-PA 126 GD12223-PA 1..126 8..133 667 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11564-PA 128 GJ11564-PA 7..127 18..132 427 68.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17044-PA 127 GK17044-PA 2..127 18..133 433 72.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22758-PA 125 GE22758-PA 1..125 8..133 612 92.9 Plus
Dyak\GE22435-PA 125 GE22435-PA 1..125 8..133 612 92.9 Plus