Clone IP19045 Report

Search the DGRC for IP19045

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:190
Well:45
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG30016-RA
Protein status:IP19045.pep: gold
Sequenced Size:469

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30016 2008-04-29 Release 5.5 accounting
CG30016 2008-05-05 Release 5.5 slip selected
CG30016 2008-08-15 Release 5.9 accounting
CG30016 2008-12-18 5.12 accounting

Clone Sequence Records

IP19045.complete Sequence

469 bp assembled on 2007-08-02

GenBank Submission: BT030864

> IP19045.complete
AATCTTAAAGTTGCCCTCAAGATGGATGCACGAAAGTTTTCTACCCACAT
ATTGGATACTTCGGTGGGAAAGGCGGCAGCCAATGTGAGAGTAACAGTTT
CCAGGCTGGACGAGATTCAGGAATGGAGATCCCTTCGGGCGGCCCAAACT
GATGCGGATGGTCGCTGCCTGCTCTTGGAACCTGGTCAATTTCCCGGCGG
GATCTATAAGCTGACCTTTCACGTGGGCGCCTATTACGCGGAGCGCAATG
TGAGGACACTTTATCCAGCAATTGACTTGATTGTGGATTGCAGTGAGAAT
CAGAACTATCACATTCCTTTGTTACTCAATCCCTTTGGGTATTCCACATA
TCGTGGAACATAGCTCGGTTAAAACCGAATAATGGATGTTACACAACTTA
CAAAAATGTAATTGATTTGAATAAAGGTTTTTTAAATGTTTAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

IP19045.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG30016-RA 663 CG30016-RA 152..593 1..442 2210 100 Plus
CG30016.a 454 CG30016.a 79..449 72..442 1855 100 Plus
CG30016.a 454 CG30016.a 26..80 1..55 275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6762489..6762876 441..54 1910 99.5 Minus
chr2R 21145070 chr2R 6762930..6762984 55..1 275 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:38:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10874896..10875284 442..54 1945 100 Minus
2R 25286936 2R 10875338..10875392 55..1 275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10876095..10876483 442..54 1945 100 Minus
2R 25260384 2R 10876537..10876591 55..1 275 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:02:01 has no hits.

IP19045.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:02:45 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6762489..6762875 55..441 99 <- Minus
chr2R 6762931..6762984 1..54 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:13:50 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..342 22..363 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:23:58 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..342 22..363 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:26 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..342 22..363 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:41 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..342 22..363 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:56:09 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..342 22..363 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:26:56 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..342 22..363 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:23:58 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..441 1..441 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:26 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..441 1..441 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:41 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..342 22..363 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:56:09 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
CG30016-RA 1..441 1..441 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:45 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10874897..10875283 55..441 100 <- Minus
2R 10875339..10875392 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:45 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10874897..10875283 55..441 100 <- Minus
2R 10875339..10875392 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:45 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10874897..10875283 55..441 100 <- Minus
2R 10875339..10875392 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:26 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6762402..6762788 55..441 100 <- Minus
arm_2R 6762844..6762897 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:55:58 Download gff for IP19045.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10876096..10876482 55..441 100 <- Minus
2R 10876538..10876591 1..54 100   Minus

IP19045.hyp Sequence

Translation from 0 to 362

> IP19045.hyp
NLKVALKMDARKFSTHILDTSVGKAAANVRVTVSRLDEIQEWRSLRAAQT
DADGRCLLLEPGQFPGGIYKLTFHVGAYYAERNVRTLYPAIDLIVDCSEN
QNYHIPLLLNPFGYSTYRGT*

IP19045.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30016-PA 113 CG30016-PA 1..113 8..120 595 100 Plus

IP19045.pep Sequence

Translation from 21 to 362

> IP19045.pep
MDARKFSTHILDTSVGKAAANVRVTVSRLDEIQEWRSLRAAQTDADGRCL
LLEPGQFPGGIYKLTFHVGAYYAERNVRTLYPAIDLIVDCSENQNYHIPL
LLNPFGYSTYRGT*

IP19045.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19762-PA 113 GF19762-PA 1..113 1..113 537 85 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22710-PA 113 GG22710-PA 1..113 1..113 586 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21178-PA 113 GH21178-PA 1..113 1..113 482 69.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG30016-PA 113 CG30016-PA 1..113 1..113 595 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18772-PA 113 GI18772-PA 1..113 1..113 438 67.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20029-PA 113 GL20029-PA 1..113 1..113 550 86.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15578-PA 113 GA15578-PA 1..113 1..113 541 85 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20486-PA 113 GM20486-PA 1..113 1..113 585 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21797-PA 113 GJ21797-PA 1..113 1..113 452 67.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20968-PA 115 GK20968-PA 1..115 1..113 449 73.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13067-PA 113 GE13067-PA 1..113 1..113 588 95.6 Plus