BDGP Sequence Production Resources |
Search the DGRC for IP19045
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 190 |
Well: | 45 |
Vector: | pOTB7_DraIII |
Associated Gene/Transcript | CG30016-RA |
Protein status: | IP19045.pep: gold |
Sequenced Size: | 469 |
Gene | Date | Evidence |
---|---|---|
CG30016 | 2008-04-29 | Release 5.5 accounting |
CG30016 | 2008-05-05 | Release 5.5 slip selected |
CG30016 | 2008-08-15 | Release 5.9 accounting |
CG30016 | 2008-12-18 | 5.12 accounting |
469 bp assembled on 2007-08-02
GenBank Submission: BT030864
> IP19045.complete AATCTTAAAGTTGCCCTCAAGATGGATGCACGAAAGTTTTCTACCCACAT ATTGGATACTTCGGTGGGAAAGGCGGCAGCCAATGTGAGAGTAACAGTTT CCAGGCTGGACGAGATTCAGGAATGGAGATCCCTTCGGGCGGCCCAAACT GATGCGGATGGTCGCTGCCTGCTCTTGGAACCTGGTCAATTTCCCGGCGG GATCTATAAGCTGACCTTTCACGTGGGCGCCTATTACGCGGAGCGCAATG TGAGGACACTTTATCCAGCAATTGACTTGATTGTGGATTGCAGTGAGAAT CAGAACTATCACATTCCTTTGTTACTCAATCCCTTTGGGTATTCCACATA TCGTGGAACATAGCTCGGTTAAAACCGAATAATGGATGTTACACAACTTA CAAAAATGTAATTGATTTGAATAAAGGTTTTTTAAATGTTTAAAAAAAAA AAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 6762489..6762875 | 55..441 | 99 | <- | Minus |
chr2R | 6762931..6762984 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..342 | 22..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..342 | 22..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..342 | 22..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..342 | 22..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..342 | 22..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..342 | 22..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..441 | 1..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..441 | 1..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..342 | 22..363 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30016-RA | 1..441 | 1..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10874897..10875283 | 55..441 | 100 | <- | Minus |
2R | 10875339..10875392 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10874897..10875283 | 55..441 | 100 | <- | Minus |
2R | 10875339..10875392 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10874897..10875283 | 55..441 | 100 | <- | Minus |
2R | 10875339..10875392 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 6762402..6762788 | 55..441 | 100 | <- | Minus |
arm_2R | 6762844..6762897 | 1..54 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10876096..10876482 | 55..441 | 100 | <- | Minus |
2R | 10876538..10876591 | 1..54 | 100 | Minus |
Translation from 0 to 362
> IP19045.hyp NLKVALKMDARKFSTHILDTSVGKAAANVRVTVSRLDEIQEWRSLRAAQT DADGRCLLLEPGQFPGGIYKLTFHVGAYYAERNVRTLYPAIDLIVDCSEN QNYHIPLLLNPFGYSTYRGT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30016-PA | 113 | CG30016-PA | 1..113 | 8..120 | 595 | 100 | Plus |
Translation from 21 to 362
> IP19045.pep MDARKFSTHILDTSVGKAAANVRVTVSRLDEIQEWRSLRAAQTDADGRCL LLEPGQFPGGIYKLTFHVGAYYAERNVRTLYPAIDLIVDCSENQNYHIPL LLNPFGYSTYRGT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19762-PA | 113 | GF19762-PA | 1..113 | 1..113 | 537 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22710-PA | 113 | GG22710-PA | 1..113 | 1..113 | 586 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21178-PA | 113 | GH21178-PA | 1..113 | 1..113 | 482 | 69.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30016-PA | 113 | CG30016-PA | 1..113 | 1..113 | 595 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18772-PA | 113 | GI18772-PA | 1..113 | 1..113 | 438 | 67.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20029-PA | 113 | GL20029-PA | 1..113 | 1..113 | 550 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15578-PA | 113 | GA15578-PA | 1..113 | 1..113 | 541 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20486-PA | 113 | GM20486-PA | 1..113 | 1..113 | 585 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21797-PA | 113 | GJ21797-PA | 1..113 | 1..113 | 452 | 67.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20968-PA | 115 | GK20968-PA | 1..115 | 1..113 | 449 | 73.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13067-PA | 113 | GE13067-PA | 1..113 | 1..113 | 588 | 95.6 | Plus |