Clone IP19070 Report

Search the DGRC for IP19070

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:190
Well:70
Vector:pOTB7_DraIII
Associated Gene/TranscriptCp16-RA
Protein status:IP19070.pep: gold
Sequenced Size:549

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cp16 2008-04-29 Release 5.5 accounting
Cp16 2008-05-05 Release 5.5 slip selected
Cp16 2008-08-15 Release 5.9 accounting
Cp16 2008-12-18 5.12 accounting

Clone Sequence Records

IP19070.complete Sequence

549 bp assembled on 2007-08-02

GenBank Submission: BT030865

> IP19070.complete
AATTAGTTTTCGAAACAGTCCGTTCCTCGCACCACCACCAAAAAAAAATG
TCCGCCACCCTACGTCTTCTCTGCCTGATGGCCTGCTGCGTCGCCCTGGC
TGTGGCCAATCGCCCCAACTACGGCGGATCCGGATACGGAGCCAGCTACG
GCGATGTGGTTAAGGCCGCTGAGACCGCCGAGGCTCAGGCTTCTGCCCTG
ACCAACGCTGCCGGAGCAGCTGCCTCCGCCGCCAAGCTGGACGGTGCTGA
CTGGAATTCCCTCAACCGTTATGGATGGGAGCAGGGTCGCCCACTTTTGG
CCAAGCCCTACGGCCCTCTGGACCCGCTATACGCTGCTGCTCTGCCACCA
CGCTCCTTCGTGGCTGAGGTCGATCCAGTCTTCAAGAAGAGCCAATACGG
CGGATCTTACGGCGAGAATGCGTACCTGAAGACCGACGCCAAACTGGGTG
TTGTGGCCATCTAAGAGCTTGGATTGTATAGCTCCAAAAGTGTTAATAAA
TAGTGATAGCTTAAAGCAATATGAAAAAAAAAAAAAAAAAAAAAAAAAA

IP19070.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Cp16-RA 753 Cp16-RA 203..724 1..522 2610 100 Plus
Cp16.a 1020 Cp16.a 499..1020 1..522 2610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8723988..8724365 1..378 1770 97.9 Plus
chr3L 24539361 chr3L 8724484..8724630 376..522 735 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:38:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8731944..8732321 1..378 1890 100 Plus
3L 28110227 3L 8732453..8732599 376..522 735 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8725044..8725421 1..378 1890 100 Plus
3L 28103327 3L 8725553..8725699 376..522 735 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:51:48 has no hits.

IP19070.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:52:31 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8723988..8724365 1..378 97 -> Plus
chr3L 8724487..8724630 379..523 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:13:52 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 1..417 48..464 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:24:07 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 1..417 48..464 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:27:44 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 1..417 48..464 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:17 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 1..417 48..464 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:21 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 1..417 48..464 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:26 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 203..724 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:24:07 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 203..724 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:27:44 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:17 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 203..724 1..522 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:21 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 1..522 1..522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:31 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8732456..8732599 379..523 99   Plus
3L 8731944..8732321 1..378 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:31 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8732456..8732599 379..523 99   Plus
3L 8731944..8732321 1..378 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:52:31 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8732456..8732599 379..523 99   Plus
3L 8731944..8732321 1..378 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:27:44 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8725044..8725421 1..378 100 -> Plus
arm_3L 8725556..8725699 379..523 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:56:08 Download gff for IP19070.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8725044..8725421 1..378 100 -> Plus
3L 8725556..8725699 379..523 99   Plus

IP19070.hyp Sequence

Translation from 2 to 463

> IP19070.hyp
LVFETVRSSHHHQKKMSATLRLLCLMACCVALAVANRPNYGGSGYGASYG
DVVKAAETAEAQASALTNAAGAAASAAKLDGADWNSLNRYGWEQGRPLLA
KPYGPLDPLYAAALPPRSFVAEVDPVFKKSQYGGSYGENAYLKTDAKLGV
VAI*

IP19070.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
Cp16-PA 138 CG6533-PA 1..138 16..153 714 100 Plus

IP19070.pep Sequence

Translation from 47 to 463

> IP19070.pep
MSATLRLLCLMACCVALAVANRPNYGGSGYGASYGDVVKAAETAEAQASA
LTNAAGAAASAAKLDGADWNSLNRYGWEQGRPLLAKPYGPLDPLYAAALP
PRSFVAEVDPVFKKSQYGGSYGENAYLKTDAKLGVVAI*

IP19070.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24350-PA 140 GF24350-PA 1..140 1..138 462 74.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14345-PA 140 GG14345-PA 1..140 1..138 530 87.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\Cp16-PA 142 GH15326-PA 1..139 1..135 376 68.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cp16-PA 138 CG6533-PA 1..138 1..138 714 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12926-PA 143 GI12926-PA 3..142 2..137 403 67.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10338-PA 106 GL10338-PA 2..105 36..138 304 77.9 Plus
Dper\GL24651-PA 107 GL24651-PA 1..89 5..114 140 46.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19666-PA 140 GA19666-PA 1..139 1..138 364 71.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25088-PA 138 GM25088-PA 1..138 1..138 543 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Cp16-PA 138 GD14124-PA 1..138 1..138 536 91.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Cp16-PA 139 GJ13070-PA 6..138 5..137 390 68.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16736-PA 137 GK16736-PA 1..137 1..138 373 69.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Cp16-PA 138 GE20775-PA 1..138 1..138 541 92 Plus