Clone IP19117 Report

Search the DGRC for IP19117

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:191
Well:17
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG14495-RA
Protein status:IP19117.pep: gold
Sequenced Size:850

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14495 2008-04-29 Release 5.5 accounting
CG14495 2008-05-05 Release 5.5 slip selected
CG14495 2008-08-15 Release 5.9 accounting
CG14495 2008-12-18 5.12 accounting

Clone Sequence Records

IP19117.complete Sequence

850 bp assembled on 2007-08-02

GenBank Submission: BT030866

> IP19117.complete
ATTCGAGACGGACGATCAAATGGAAGCACTACGTCGATTTTTAAGAACGG
AGACTCGTTGTCGCCTCAACGGGATACATACCCTAATATTGTGTGTCCTA
TTTTTGGGTTTTTCGGTGGCTGGTGAGATGCCGGATTTGTTCACTCCCGA
ACCGGATCTCACGATAGACGAATGCCACGATGAGTTCACCATTGCCTGTG
CCAACGCTTCACTGGTCTTCTCCGATTCCTACGATCTGTGCGAACTGAAT
GCCAATGAGACCATCATCAATCTAGAGGTCGATGTTGAACTGGAGCGACT
CCAAATCGAGTTGGGATCCAGTGCGGTGTGCGGCAATATGCAAATCTGCG
ATACATTGGTTGACGATCTGGAGTACTTTCAGTGCATCAATAAGAACGGA
ATCCATAACCTCGACATTCTGACCGAAATAAATTACAATGCCACAAGTGC
TTACACACGACTTCACGAGGACTATGATGCAGTGCATCGGGCGCTTCTGC
TTTGCGGCCTCGATGCCCAAAAAAAGTACATGGAGGACATAAGACAGGCC
CACAGAGAACTCACTAAATGTCGATCCGAAATCGACGAGCTTAACGAGTA
GTCGTCGCTTATCTGTCACTATACTAACAAAATGATTAAGGGTGAATAAA
CACCATCATATAAGCAGCTAAATCACTATAGTTTACCAAGAATTGATATT
ATTGGCTGATAAGAATAAAACTTTTAGGATTTGTTAATTGCCAGATCCAT
CTTAGATATATTAAGTCAGTATATATATATAACTTCCATAGTTAAGTTAT
ATTATACATGGAAGTACAATAAATATTTATTAATGTCCAAAAAAAAAAAA

IP19117.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14495-RA 1094 CG14495-RA 173..1012 1..840 4185 99.8 Plus
CG34005-RB 693 CG34005-RB 583..693 840..730 540 99 Minus
CG34005.a 703 CG34005.a 593..703 840..730 540 99 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13935925..13936367 836..398 2030 97.7 Minus
chr2R 21145070 chr2R 13936451..13936848 398..1 1975 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:38:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18048802..18049244 840..398 2200 99.8 Minus
2R 25286936 2R 18049328..18049725 398..1 1990 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18050001..18050443 840..398 2200 99.7 Minus
2R 25260384 2R 18050527..18050924 398..1 1990 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:15:01 has no hits.

IP19117.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:16:12 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13935923..13936367 398..838 97 <- Minus
chr2R 13936452..13936848 1..397 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:13:56 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:26 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:50:22 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:37 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:11:33 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:50 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..838 1..838 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:26 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..838 1..838 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:50:22 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..838 1..838 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:37 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:33 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
CG14495-RA 1..838 1..838 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:12 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18048804..18049244 398..838 99 <- Minus
2R 18049329..18049725 1..397 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:12 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18048804..18049244 398..838 99 <- Minus
2R 18049329..18049725 1..397 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:16:12 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18048804..18049244 398..838 99 <- Minus
2R 18049329..18049725 1..397 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:50:22 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13936309..13936749 398..838 99 <- Minus
arm_2R 13936834..13937230 1..397 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:57:35 Download gff for IP19117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18050003..18050443 398..838 99 <- Minus
2R 18050528..18050924 1..397 100   Minus

IP19117.hyp Sequence

Translation from 0 to 600

> IP19117.hyp
FETDDQMEALRRFLRTETRCRLNGIHTLILCVLFLGFSVAGEMPDLFTPE
PDLTIDECHDEFTIACANASLVFSDSYDLCELNANETIINLEVDVELERL
QIELGSSAVCGNMQICDTLVDDLEYFQCINKNGIHNLDILTEINYNATSA
YTRLHEDYDAVHRALLLCGLDAQKKYMEDIRQAHRELTKCRSEIDELNE*

IP19117.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14495-PB 157 CG14495-PB 1..157 43..199 829 100 Plus
CG14495-PA 157 CG14495-PA 1..157 43..199 829 100 Plus

IP19117.pep Sequence

Translation from 19 to 600

> IP19117.pep
MEALRRFLRTETRCRLNGIHTLILCVLFLGFSVAGEMPDLFTPEPDLTID
ECHDEFTIACANASLVFSDSYDLCELNANETIINLEVDVELERLQIELGS
SAVCGNMQICDTLVDDLEYFQCINKNGIHNLDILTEINYNATSAYTRLHE
DYDAVHRALLLCGLDAQKKYMEDIRQAHRELTKCRSEIDELNE*

IP19117.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13210-PA 156 GF13210-PA 2..156 39..193 617 74.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20999-PA 193 GG20999-PA 1..193 1..193 848 90.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20453-PA 137 GH20453-PA 2..134 58..190 334 48.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14495-PD 193 CG14495-PD 1..193 1..193 1013 100 Plus
CG14495-PC 193 CG14495-PC 1..193 1..193 1013 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19280-PA 209 GI19280-PA 28..207 20..192 432 48.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10542-PA 126 GL10542-PA 2..118 45..185 369 52.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13030-PA 192 GA13030-PA 1..184 1..185 530 56.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19933-PA 194 GM19933-PA 1..192 1..192 943 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25422-PA 194 GD25422-PA 1..192 1..192 949 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22157-PA 204 GJ22157-PA 35..201 24..190 423 47.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22062-PA 173 GK22062-PA 28..171 50..193 406 56.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13942-PA 193 GE13942-PA 1..193 1..193 858 89.6 Plus