BDGP Sequence Production Resources |
Search the DGRC for IP19126
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 191 |
Well: | 26 |
Vector: | pOTB7_DraIII |
Associated Gene/Transcript | CG15423-RA |
Protein status: | IP19126.pep: gold |
Sequenced Size: | 554 |
Gene | Date | Evidence |
---|---|---|
CG15423 | 2008-04-29 | Release 5.5 accounting |
CG15423 | 2008-05-05 | Release 5.5 slip selected |
CG15423 | 2008-08-15 | Release 5.9 accounting |
CG15423 | 2008-12-18 | 5.12 accounting |
554 bp assembled on 2007-08-02
GenBank Submission: BT030867
> IP19126.complete AGTTCGAGAAAGCAGTCAAAGGCATTCACTTCACCCACTAAGGATACAAT ACTTGGATAGTTTCTGAAGAAAATGCCGTACTACGAGGAGGAACGTCGTC ATCACCATCATCACCATCACGGTGGAAGGCCAATTGTAGAGGTGGACATT GTGCCGCCAAGGATTCCTCGACCAGTGATTGAGATCGGAGTGGGCGGCCG GTATCCACCACCACCGCCCAGGGTGGAGGTCATCACACCAGCTGCCGTCT ACCAGCCGCCACCACCACGACCCATTATCGAGGTGGATGTGGTGCCACCA AGAGCTCCCTTCATCGAGTTCAACATCGGCGGTCGGCGTCCACCTCCCAG GGAAGAGGTCATCATCGTTCAGCAACCCCCACCGCCCAGGTGGTAGGCGT GGTCTCCATATGACCGTCGTTCAACAACGAAGTAAAAAACTTTAAAAATA TTTATTAAACTTCATGTATTTCTGCAAATAGAAACTATAAACTAACTTTT TACAAAACCTAAGCTCTTGTATAATAACAAAAAAAAAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15423-RA | 567 | CG15423-RA | 1..545 | 1..545 | 2650 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 4005475..4006001 | 1..527 | 2560 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4006041..4006585 | 1..545 | 2650 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4006041..4006585 | 1..545 | 2650 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 4005475..4005993 | 1..519 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..324 | 73..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..324 | 73..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..324 | 73..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..324 | 73..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..324 | 73..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..527 | 1..527 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..527 | 1..528 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..527 | 1..528 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..527 | 1..527 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15423-RA | 1..527 | 1..528 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4006041..4006567 | 1..528 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4006041..4006567 | 1..528 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4006041..4006567 | 1..528 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 4006041..4006567 | 1..528 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4006041..4006567 | 1..528 | 99 | Plus |
Translation from 72 to 395
> IP19126.hyp MPYYEEERRHHHHHHHGGRPIVEVDIVPPRIPRPVIEIGVGGRYPPPPPR VEVITPAAVYQPPPPRPIIEVDVVPPRAPFIEFNIGGRRPPPREEVIIVQ QPPPPRW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15423-PA | 107 | CG15423-PA | 1..107 | 1..107 | 608 | 100 | Plus |
Translation from 72 to 395
> IP19126.pep MPYYEEERRHHHHHHHGGRPIVEVDIVPPRIPRPVIEIGVGGRYPPPPPR VEVITPAAVYQPPPPRPIIEVDVVPPRAPFIEFNIGGRRPPPREEVIIVQ QPPPPRW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20687-PA | 105 | GF20687-PA | 1..105 | 1..107 | 333 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24978-PA | 106 | GG24978-PA | 1..106 | 1..107 | 474 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11533-PA | 132 | GH11533-PA | 46..131 | 1..89 | 169 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15423-PA | 107 | CG15423-PA | 1..107 | 1..107 | 608 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17024-PA | 101 | GI17024-PA | 1..99 | 1..104 | 262 | 70.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18839-PA | 111 | GL18839-PA | 1..111 | 1..107 | 281 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25822-PA | 111 | GA25822-PA | 1..111 | 1..107 | 281 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18450-PA | 107 | GM18450-PA | 1..107 | 1..107 | 484 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23266-PA | 107 | GD23266-PA | 1..107 | 1..107 | 491 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24527-PA | 108 | GJ24527-PA | 1..106 | 1..104 | 269 | 77.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23902-PA | 116 | GK23902-PA | 19..116 | 14..107 | 223 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18268-PA | 107 | GE18268-PA | 1..107 | 1..107 | 451 | 96.3 | Plus |