Clone IP19126 Report

Search the DGRC for IP19126

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:191
Well:26
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG15423-RA
Protein status:IP19126.pep: gold
Sequenced Size:554

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15423 2008-04-29 Release 5.5 accounting
CG15423 2008-05-05 Release 5.5 slip selected
CG15423 2008-08-15 Release 5.9 accounting
CG15423 2008-12-18 5.12 accounting

Clone Sequence Records

IP19126.complete Sequence

554 bp assembled on 2007-08-02

GenBank Submission: BT030867

> IP19126.complete
AGTTCGAGAAAGCAGTCAAAGGCATTCACTTCACCCACTAAGGATACAAT
ACTTGGATAGTTTCTGAAGAAAATGCCGTACTACGAGGAGGAACGTCGTC
ATCACCATCATCACCATCACGGTGGAAGGCCAATTGTAGAGGTGGACATT
GTGCCGCCAAGGATTCCTCGACCAGTGATTGAGATCGGAGTGGGCGGCCG
GTATCCACCACCACCGCCCAGGGTGGAGGTCATCACACCAGCTGCCGTCT
ACCAGCCGCCACCACCACGACCCATTATCGAGGTGGATGTGGTGCCACCA
AGAGCTCCCTTCATCGAGTTCAACATCGGCGGTCGGCGTCCACCTCCCAG
GGAAGAGGTCATCATCGTTCAGCAACCCCCACCGCCCAGGTGGTAGGCGT
GGTCTCCATATGACCGTCGTTCAACAACGAAGTAAAAAACTTTAAAAATA
TTTATTAAACTTCATGTATTTCTGCAAATAGAAACTATAAACTAACTTTT
TACAAAACCTAAGCTCTTGTATAATAACAAAAAAAAAAAAAAAAAAAAAA
AAAA

IP19126.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-RA 567 CG15423-RA 1..545 1..545 2650 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4005475..4006001 1..527 2560 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:38:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4006041..4006585 1..545 2650 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4006041..4006585 1..545 2650 99 Plus
Blast to na_te.dros performed on 2019-03-16 08:26:10 has no hits.

IP19126.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:27:21 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4005475..4005993 1..519 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:14:01 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..324 73..396 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:24:09 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..324 73..396 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:43 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..324 73..396 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:20 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..324 73..396 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:40:31 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..324 73..396 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:27 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..527 1..527 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:24:09 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..527 1..528 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:43 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..527 1..528 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:20 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..527 1..527 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:40:31 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 1..527 1..528 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:21 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4006041..4006567 1..528 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:21 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4006041..4006567 1..528 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:27:21 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4006041..4006567 1..528 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:43 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4006041..4006567 1..528 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:56:09 Download gff for IP19126.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4006041..4006567 1..528 99   Plus

IP19126.hyp Sequence

Translation from 72 to 395

> IP19126.hyp
MPYYEEERRHHHHHHHGGRPIVEVDIVPPRIPRPVIEIGVGGRYPPPPPR
VEVITPAAVYQPPPPRPIIEVDVVPPRAPFIEFNIGGRRPPPREEVIIVQ
QPPPPRW*

IP19126.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-PA 107 CG15423-PA 1..107 1..107 608 100 Plus

IP19126.pep Sequence

Translation from 72 to 395

> IP19126.pep
MPYYEEERRHHHHHHHGGRPIVEVDIVPPRIPRPVIEIGVGGRYPPPPPR
VEVITPAAVYQPPPPRPIIEVDVVPPRAPFIEFNIGGRRPPPREEVIIVQ
QPPPPRW*

IP19126.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20687-PA 105 GF20687-PA 1..105 1..107 333 84.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24978-PA 106 GG24978-PA 1..106 1..107 474 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11533-PA 132 GH11533-PA 46..131 1..89 169 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-PA 107 CG15423-PA 1..107 1..107 608 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17024-PA 101 GI17024-PA 1..99 1..104 262 70.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18839-PA 111 GL18839-PA 1..111 1..107 281 80.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25822-PA 111 GA25822-PA 1..111 1..107 281 80.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18450-PA 107 GM18450-PA 1..107 1..107 484 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23266-PA 107 GD23266-PA 1..107 1..107 491 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24527-PA 108 GJ24527-PA 1..106 1..104 269 77.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23902-PA 116 GK23902-PA 19..116 14..107 223 82.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18268-PA 107 GE18268-PA 1..107 1..107 451 96.3 Plus