Clone IP19169 Report

Search the DGRC for IP19169

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:191
Well:69
Vector:pOTB7_DraIII
Associated Gene/TranscriptCp19-RA
Protein status:IP19169.pep: gold
Sequenced Size:677

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cp19 2008-04-29 Release 5.5 accounting
Cp19 2008-05-05 Release 5.5 slip selected
Cp19 2008-08-15 Release 5.9 accounting
Cp19 2008-12-18 5.12 accounting

Clone Sequence Records

IP19169.complete Sequence

677 bp assembled on 2007-08-02

GenBank Submission: BT030873

> IP19169.complete
ATGTTAATTCAGCCAACTGTGCCAAAACCCATACATCATAGCCATGAACA
AGTTCGCTACTCTGGCAGTCATCTTCTGCGCCTGCATCGTGGGCAGCTGC
TACGCCAACTACGGTGGCCAGCAGAGCTACGGACAGCGATCTTACGGTCA
GGATAGCTCCGCCGCCTCCGCCGCCAGCTCAGCAGCTGCTGCTGGAGCCG
AGGGTCAGCAGCGTTATGAGCGCCCCGTGGAGATCATCGCCGGCGGTTAC
CGCGGCAGCTATGCCCCCGAGATCCTGCGTCCCATCCAGGTCAGCGGTGG
ATATGGCGGTGAGCGACGTGGCTACAACGGTGGCAACTACCGTCGTGCCG
GCTACGGACCCCGTTGGACTGTCCAGCCCGCCGGTGCCACCCTCCTGTAC
CCCGGCCAGAACAACTACAAGGCTTACGTCTCGCCCCCGGAGTACAGCAA
GGTGATCCTGCCCATCCGCCCTGCTGCTCCAGTGGCCAAGCTTTTCGTCC
CAGAGAACCAGTATGGCAACCAGTACGTTAGCCAGTACTCTGCACCCCGC
AGCAGCGGCTACTAAGCGCATACTTGATTATCCCCAGCCAACCTGGCGGA
TACTTGATCTCAGCCTGATCGTGTACATAATAAACAACAAGAAAAAATAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

IP19169.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Cp19-RA 902 Cp19-RA 225..872 1..648 3240 100 Plus
Cp19.b 1479 Cp19.b 225..872 1..648 3240 100 Plus
Cp19.a 892 Cp19.a 300..889 59..648 2950 100 Plus
Cp19.a 892 Cp19.a 225..282 1..58 290 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8722058..8722647 59..648 2920 99.7 Plus
chr3L 24539361 chr3L 8721911..8721968 1..58 290 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:38:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8730012..8730601 59..648 2950 100 Plus
3L 28110227 3L 8729865..8729922 1..58 290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8723112..8723701 59..648 2950 100 Plus
3L 28103327 3L 8722965..8723022 1..58 290 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:05:31 has no hits.

IP19169.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:06:07 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8721911..8721968 1..58 100 -> Plus
chr3L 8722058..8722647 59..648 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:14:19 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..522 44..565 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:19 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..522 44..565 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:14 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..522 44..565 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:00 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..522 44..565 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:22:51 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..522 44..565 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:05 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:19 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:14 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:04:01 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:22:51 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
Cp19-RA 1..648 1..648 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:07 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8729865..8729922 1..58 100 -> Plus
3L 8730012..8730601 59..648 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:07 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8729865..8729922 1..58 100 -> Plus
3L 8730012..8730601 59..648 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:07 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8729865..8729922 1..58 100 -> Plus
3L 8730012..8730601 59..648 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:14 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8722965..8723022 1..58 100 -> Plus
arm_3L 8723112..8723701 59..648 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:57:27 Download gff for IP19169.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8723112..8723701 59..648 100   Plus
3L 8722965..8723022 1..58 100 -> Plus

IP19169.pep Sequence

Translation from 43 to 564

> IP19169.pep
MNKFATLAVIFCACIVGSCYANYGGQQSYGQRSYGQDSSAASAASSAAAA
GAEGQQRYERPVEIIAGGYRGSYAPEILRPIQVSGGYGGERRGYNGGNYR
RAGYGPRWTVQPAGATLLYPGQNNYKAYVSPPEYSKVILPIRPAAPVAKL
FVPENQYGNQYVSQYSAPRSSGY*

IP19169.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24349-PA 191 GF24349-PA 1..189 1..169 408 59.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14344-PA 185 GG14344-PA 1..185 1..173 626 90.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24992-PA 196 GH24992-PA 1..193 1..160 264 44.4 Plus
Dgri\Cp19-PA 120 GH15325-PA 63..117 106..160 216 74.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cp19-PA 173 CG6524-PA 1..173 1..173 919 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12925-PA 195 GI12925-PA 1..188 1..159 257 43 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10337-PA 188 GL10337-PA 1..161 1..160 389 61.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19663-PA 194 GA19663-PA 1..161 1..160 389 60.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25087-PA 173 GM25087-PA 1..173 1..173 859 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14123-PA 173 GD14123-PA 1..173 1..173 857 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Cp19-PA 198 GJ13068-PA 1..188 1..160 323 49.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16735-PA 193 GK16735-PA 1..183 1..159 362 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20774-PA 177 GE20774-PA 1..177 1..173 844 96.6 Plus

IP19169.hyp Sequence

Translation from 43 to 564

> IP19169.hyp
MNKFATLAVIFCACIVGSCYANYGGQQSYGQRSYGQDSSAASAASSAAAA
GAEGQQRYERPVEIIAGGYRGSYAPEILRPIQVSGGYGGERRGYNGGNYR
RAGYGPRWTVQPAGATLLYPGQNNYKAYVSPPEYSKVILPIRPAAPVAKL
FVPENQYGNQYVSQYSAPRSSGY*

IP19169.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cp19-PA 173 CG6524-PA 1..173 1..173 919 100 Plus