BDGP Sequence Production Resources |
Search the DGRC for IP19169
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 191 |
Well: | 69 |
Vector: | pOTB7_DraIII |
Associated Gene/Transcript | Cp19-RA |
Protein status: | IP19169.pep: gold |
Sequenced Size: | 677 |
Gene | Date | Evidence |
---|---|---|
Cp19 | 2008-04-29 | Release 5.5 accounting |
Cp19 | 2008-05-05 | Release 5.5 slip selected |
Cp19 | 2008-08-15 | Release 5.9 accounting |
Cp19 | 2008-12-18 | 5.12 accounting |
677 bp assembled on 2007-08-02
GenBank Submission: BT030873
> IP19169.complete ATGTTAATTCAGCCAACTGTGCCAAAACCCATACATCATAGCCATGAACA AGTTCGCTACTCTGGCAGTCATCTTCTGCGCCTGCATCGTGGGCAGCTGC TACGCCAACTACGGTGGCCAGCAGAGCTACGGACAGCGATCTTACGGTCA GGATAGCTCCGCCGCCTCCGCCGCCAGCTCAGCAGCTGCTGCTGGAGCCG AGGGTCAGCAGCGTTATGAGCGCCCCGTGGAGATCATCGCCGGCGGTTAC CGCGGCAGCTATGCCCCCGAGATCCTGCGTCCCATCCAGGTCAGCGGTGG ATATGGCGGTGAGCGACGTGGCTACAACGGTGGCAACTACCGTCGTGCCG GCTACGGACCCCGTTGGACTGTCCAGCCCGCCGGTGCCACCCTCCTGTAC CCCGGCCAGAACAACTACAAGGCTTACGTCTCGCCCCCGGAGTACAGCAA GGTGATCCTGCCCATCCGCCCTGCTGCTCCAGTGGCCAAGCTTTTCGTCC CAGAGAACCAGTATGGCAACCAGTACGTTAGCCAGTACTCTGCACCCCGC AGCAGCGGCTACTAAGCGCATACTTGATTATCCCCAGCCAACCTGGCGGA TACTTGATCTCAGCCTGATCGTGTACATAATAAACAACAAGAAAAAATAA AAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cp19-RA | 902 | Cp19-RA | 225..872 | 1..648 | 3240 | 100 | Plus |
Cp19.b | 1479 | Cp19.b | 225..872 | 1..648 | 3240 | 100 | Plus |
Cp19.a | 892 | Cp19.a | 300..889 | 59..648 | 2950 | 100 | Plus |
Cp19.a | 892 | Cp19.a | 225..282 | 1..58 | 290 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8721911..8721968 | 1..58 | 100 | -> | Plus |
chr3L | 8722058..8722647 | 59..648 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..522 | 44..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..522 | 44..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..522 | 44..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..522 | 44..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..522 | 44..565 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..648 | 1..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..648 | 1..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..648 | 1..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..648 | 1..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp19-RA | 1..648 | 1..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8729865..8729922 | 1..58 | 100 | -> | Plus |
3L | 8730012..8730601 | 59..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8729865..8729922 | 1..58 | 100 | -> | Plus |
3L | 8730012..8730601 | 59..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8729865..8729922 | 1..58 | 100 | -> | Plus |
3L | 8730012..8730601 | 59..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8722965..8723022 | 1..58 | 100 | -> | Plus |
arm_3L | 8723112..8723701 | 59..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8723112..8723701 | 59..648 | 100 | Plus | |
3L | 8722965..8723022 | 1..58 | 100 | -> | Plus |
Translation from 43 to 564
> IP19169.pep MNKFATLAVIFCACIVGSCYANYGGQQSYGQRSYGQDSSAASAASSAAAA GAEGQQRYERPVEIIAGGYRGSYAPEILRPIQVSGGYGGERRGYNGGNYR RAGYGPRWTVQPAGATLLYPGQNNYKAYVSPPEYSKVILPIRPAAPVAKL FVPENQYGNQYVSQYSAPRSSGY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24349-PA | 191 | GF24349-PA | 1..189 | 1..169 | 408 | 59.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14344-PA | 185 | GG14344-PA | 1..185 | 1..173 | 626 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24992-PA | 196 | GH24992-PA | 1..193 | 1..160 | 264 | 44.4 | Plus |
Dgri\Cp19-PA | 120 | GH15325-PA | 63..117 | 106..160 | 216 | 74.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cp19-PA | 173 | CG6524-PA | 1..173 | 1..173 | 919 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12925-PA | 195 | GI12925-PA | 1..188 | 1..159 | 257 | 43 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10337-PA | 188 | GL10337-PA | 1..161 | 1..160 | 389 | 61.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19663-PA | 194 | GA19663-PA | 1..161 | 1..160 | 389 | 60.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25087-PA | 173 | GM25087-PA | 1..173 | 1..173 | 859 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14123-PA | 173 | GD14123-PA | 1..173 | 1..173 | 857 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Cp19-PA | 198 | GJ13068-PA | 1..188 | 1..160 | 323 | 49.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16735-PA | 193 | GK16735-PA | 1..183 | 1..159 | 362 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20774-PA | 177 | GE20774-PA | 1..177 | 1..173 | 844 | 96.6 | Plus |
Translation from 43 to 564
> IP19169.hyp MNKFATLAVIFCACIVGSCYANYGGQQSYGQRSYGQDSSAASAASSAAAA GAEGQQRYERPVEIIAGGYRGSYAPEILRPIQVSGGYGGERRGYNGGNYR RAGYGPRWTVQPAGATLLYPGQNNYKAYVSPPEYSKVILPIRPAAPVAKL FVPENQYGNQYVSQYSAPRSSGY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cp19-PA | 173 | CG6524-PA | 1..173 | 1..173 | 919 | 100 | Plus |