Clone IP19362 Report

Search the DGRC for IP19362

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:193
Well:62
Vector:pOTB7_DraIII
Associated Gene/TranscriptCp18-RA
Protein status:IP19362.pep: gold
Sequenced Size:678

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cp18 2008-04-29 Release 5.5 accounting
Cp18 2008-05-05 Release 5.5 slip selected
Cp18 2008-08-15 Release 5.9 accounting
Cp18 2008-12-18 5.12 accounting

Clone Sequence Records

IP19362.complete Sequence

678 bp assembled on 2007-08-02

GenBank Submission: BT030880

> IP19362.complete
ATTAGTTACCTTCGCATCGATCAACTAACCAACTCAGCCTCAGAATGATG
AAGTTCATGTGCATCTGCCTCTGCGCCATCTCTGCCGTTTCGGCCAACTC
CTACGGACGTTCCCGTGGTGGATACGGTGGTGCCCCAGTCGGTGGCTATG
CCTACCAGGTGCAGCCTGCCCTGACCGTTAAGGCGATCGTTCCCTCATAC
GGTGGTGGATACGGCGGAAACCATGGAGGATATGGCGGTGCCTACGAGTC
GGTGCCTGTGCCCGTGTCCTCTGCCTACAGCGGTGCCAATGTGGGATCTC
AGTACTCCGGTTCCGGCTACGGCGGTGCCCCACCAGTTGATGCCCAGGCC
ATTGCCCTCGCCAAGCTCGCCCTGGCCGCTCCCAGCGCTGGAGCTCCTCT
GGTCTGGAAGGAGGCTCCCCGCTACGCCCAGCCCGTCTATCCCCCCACCA
GCTACGTGAACCAGGAGTACGGACACAGCGAGAAGGTGAAGGGAGGCTCC
GCAGCCGCTGCTGCCAGCTCCGTGGCCGCCGGAAAGAAGGGCTACAAGAG
GCCCAGCTACTAAGTGGCAAAACGTTGAACAGTGAACCAAAAACTTACCT
GCCCATAAGGAACTAGGTCATAATAATAAAAGCCAAAACATCAAGACTTA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP19362.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Cp18-RA 1202 Cp18-RA 554..1202 1..649 3245 100 Plus
MB6.chr3L.pasa.6925.a 632 MB6.chr3L.pasa.6925.a 68..552 543..59 2425 100 Minus
MB6.chr3L.pasa.6925.a 632 MB6.chr3L.pasa.6925.a 15..69 653..599 275 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8719067..8719657 59..649 2895 99.3 Plus
chr3L 24539361 chr3L 8718831..8718889 1..59 295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:38:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8727023..8727617 59..653 2975 100 Plus
3L 28110227 3L 8726791..8726849 1..59 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8720123..8720717 59..653 2975 100 Plus
3L 28103327 3L 8719891..8719949 1..59 295 100 Plus
Blast to na_te.dros performed 2019-03-16 01:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 2971..3029 590..649 108 66.7 Plus

IP19362.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:07:21 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8718831..8718889 1..59 100 -> Plus
chr3L 8719068..8719657 60..649 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:14:40 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..519 45..563 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:25:11 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..519 45..563 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:20 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..519 45..563 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:25 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..519 45..563 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:23:00 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..519 45..563 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:25 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:25:11 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:20 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:25 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:23:00 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
Cp18-RA 1..649 1..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:21 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8726791..8726849 1..59 100 -> Plus
3L 8727024..8727613 60..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:21 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8726791..8726849 1..59 100 -> Plus
3L 8727024..8727613 60..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:21 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8726791..8726849 1..59 100 -> Plus
3L 8727024..8727613 60..649 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:20 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8719891..8719949 1..59 100 -> Plus
arm_3L 8720124..8720713 60..649 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:57:19 Download gff for IP19362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8720124..8720713 60..649 100   Plus
3L 8719891..8719949 1..59 100 -> Plus

IP19362.pep Sequence

Translation from 44 to 562

> IP19362.pep
MMKFMCICLCAISAVSANSYGRSRGGYGGAPVGGYAYQVQPALTVKAIVP
SYGGGYGGNHGGYGGAYESVPVPVSSAYSGANVGSQYSGSGYGGAPPVDA
QAIALAKLALAAPSAGAPLVWKEAPRYAQPVYPPTSYVNQEYGHSEKVKG
GSAAAAASSVAAGKKGYKRPSY*

IP19362.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24347-PA 171 GF24347-PA 1..171 1..172 208 77.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14342-PA 170 GG14342-PA 1..170 1..172 421 89 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\Cp18-PA 166 GH15323-PA 1..120 1..129 233 55.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cp18-PA 172 CG6517-PA 1..172 1..172 907 100 Plus
CG14191-PA 193 CG14191-PA 55..155 21..116 139 35.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12922-PA 170 GI12922-PA 1..165 1..172 322 58 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10335-PA 176 GL10335-PA 1..176 1..172 339 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19656-PA 176 GA19656-PA 1..176 1..172 339 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25085-PA 172 GM25085-PA 1..172 1..172 809 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14120-PA 174 GD14120-PA 8..174 6..172 780 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Cp18-PA 170 GJ13066-PA 1..165 1..172 322 57.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16733-PA 165 GK16733-PA 1..165 1..172 321 66.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20772-PA 175 GE20772-PA 1..175 1..172 460 89.7 Plus

IP19362.hyp Sequence

Translation from 44 to 562

> IP19362.hyp
MMKFMCICLCAISAVSANSYGRSRGGYGGAPVGGYAYQVQPALTVKAIVP
SYGGGYGGNHGGYGGAYESVPVPVSSAYSGANVGSQYSGSGYGGAPPVDA
QAIALAKLALAAPSAGAPLVWKEAPRYAQPVYPPTSYVNQEYGHSEKVKG
GSAAAAASSVAAGKKGYKRPSY*

IP19362.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cp18-PA 172 CG6517-PA 1..172 1..172 907 100 Plus
CG14191-PA 193 CG14191-PA 55..155 21..116 139 35.6 Plus