BDGP Sequence Production Resources |
Search the DGRC for IP19362
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 193 |
Well: | 62 |
Vector: | pOTB7_DraIII |
Associated Gene/Transcript | Cp18-RA |
Protein status: | IP19362.pep: gold |
Sequenced Size: | 678 |
Gene | Date | Evidence |
---|---|---|
Cp18 | 2008-04-29 | Release 5.5 accounting |
Cp18 | 2008-05-05 | Release 5.5 slip selected |
Cp18 | 2008-08-15 | Release 5.9 accounting |
Cp18 | 2008-12-18 | 5.12 accounting |
678 bp assembled on 2007-08-02
GenBank Submission: BT030880
> IP19362.complete ATTAGTTACCTTCGCATCGATCAACTAACCAACTCAGCCTCAGAATGATG AAGTTCATGTGCATCTGCCTCTGCGCCATCTCTGCCGTTTCGGCCAACTC CTACGGACGTTCCCGTGGTGGATACGGTGGTGCCCCAGTCGGTGGCTATG CCTACCAGGTGCAGCCTGCCCTGACCGTTAAGGCGATCGTTCCCTCATAC GGTGGTGGATACGGCGGAAACCATGGAGGATATGGCGGTGCCTACGAGTC GGTGCCTGTGCCCGTGTCCTCTGCCTACAGCGGTGCCAATGTGGGATCTC AGTACTCCGGTTCCGGCTACGGCGGTGCCCCACCAGTTGATGCCCAGGCC ATTGCCCTCGCCAAGCTCGCCCTGGCCGCTCCCAGCGCTGGAGCTCCTCT GGTCTGGAAGGAGGCTCCCCGCTACGCCCAGCCCGTCTATCCCCCCACCA GCTACGTGAACCAGGAGTACGGACACAGCGAGAAGGTGAAGGGAGGCTCC GCAGCCGCTGCTGCCAGCTCCGTGGCCGCCGGAAAGAAGGGCTACAAGAG GCCCAGCTACTAAGTGGCAAAACGTTGAACAGTGAACCAAAAACTTACCT GCCCATAAGGAACTAGGTCATAATAATAAAAGCCAAAACATCAAGACTTA AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cp18-RA | 1202 | Cp18-RA | 554..1202 | 1..649 | 3245 | 100 | Plus |
MB6.chr3L.pasa.6925.a | 632 | MB6.chr3L.pasa.6925.a | 68..552 | 543..59 | 2425 | 100 | Minus |
MB6.chr3L.pasa.6925.a | 632 | MB6.chr3L.pasa.6925.a | 15..69 | 653..599 | 275 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tabor | 7345 | Tabor TABOR 7345bp | 2971..3029 | 590..649 | 108 | 66.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8718831..8718889 | 1..59 | 100 | -> | Plus |
chr3L | 8719068..8719657 | 60..649 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..519 | 45..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..519 | 45..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..519 | 45..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..519 | 45..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..519 | 45..563 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..649 | 1..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..649 | 1..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..649 | 1..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..649 | 1..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cp18-RA | 1..649 | 1..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8726791..8726849 | 1..59 | 100 | -> | Plus |
3L | 8727024..8727613 | 60..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8726791..8726849 | 1..59 | 100 | -> | Plus |
3L | 8727024..8727613 | 60..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8726791..8726849 | 1..59 | 100 | -> | Plus |
3L | 8727024..8727613 | 60..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8719891..8719949 | 1..59 | 100 | -> | Plus |
arm_3L | 8720124..8720713 | 60..649 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8720124..8720713 | 60..649 | 100 | Plus | |
3L | 8719891..8719949 | 1..59 | 100 | -> | Plus |
Translation from 44 to 562
> IP19362.pep MMKFMCICLCAISAVSANSYGRSRGGYGGAPVGGYAYQVQPALTVKAIVP SYGGGYGGNHGGYGGAYESVPVPVSSAYSGANVGSQYSGSGYGGAPPVDA QAIALAKLALAAPSAGAPLVWKEAPRYAQPVYPPTSYVNQEYGHSEKVKG GSAAAAASSVAAGKKGYKRPSY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24347-PA | 171 | GF24347-PA | 1..171 | 1..172 | 208 | 77.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14342-PA | 170 | GG14342-PA | 1..170 | 1..172 | 421 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\Cp18-PA | 166 | GH15323-PA | 1..120 | 1..129 | 233 | 55.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cp18-PA | 172 | CG6517-PA | 1..172 | 1..172 | 907 | 100 | Plus |
CG14191-PA | 193 | CG14191-PA | 55..155 | 21..116 | 139 | 35.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12922-PA | 170 | GI12922-PA | 1..165 | 1..172 | 322 | 58 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10335-PA | 176 | GL10335-PA | 1..176 | 1..172 | 339 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19656-PA | 176 | GA19656-PA | 1..176 | 1..172 | 339 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25085-PA | 172 | GM25085-PA | 1..172 | 1..172 | 809 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14120-PA | 174 | GD14120-PA | 8..174 | 6..172 | 780 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Cp18-PA | 170 | GJ13066-PA | 1..165 | 1..172 | 322 | 57.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16733-PA | 165 | GK16733-PA | 1..165 | 1..172 | 321 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20772-PA | 175 | GE20772-PA | 1..175 | 1..172 | 460 | 89.7 | Plus |
Translation from 44 to 562
> IP19362.hyp MMKFMCICLCAISAVSANSYGRSRGGYGGAPVGGYAYQVQPALTVKAIVP SYGGGYGGNHGGYGGAYESVPVPVSSAYSGANVGSQYSGSGYGGAPPVDA QAIALAKLALAAPSAGAPLVWKEAPRYAQPVYPPTSYVNQEYGHSEKVKG GSAAAAASSVAAGKKGYKRPSY*