Clone IP19603 Report

Search the DGRC for IP19603

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:196
Well:3
Vector:pOTB7_DraIII
Associated Gene/TranscriptCp38-RA
Protein status:IP19603.pep: gold
Sequenced Size:1139

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cp38 2008-04-29 Release 5.5 accounting
Cp38 2008-05-05 Release 5.5 slip selected
Cp38 2008-08-15 Release 5.9 accounting
Cp38 2008-12-18 5.12 accounting

Clone Sequence Records

IP19603.complete Sequence

1139 bp assembled on 2007-11-15

GenBank Submission: BT031224

> IP19603.complete
AGCAGAAGACAGCAGACAGTCCAAGCGGGAGCACACCAGAAGCCGAAGAG
CGACTGGAACTGCAACTGGGAGACAAGATGACGAGATCGACCTACATTTG
GGCGCTGGCCGCCTGCCTGATCGCCTGTGCAAGCGCCAACTACGGCAGTT
CCCAGGGCTATGGACCCGAGTCCGGAAGCGGTGCCTCCGATGGCGGTGCT
GATGCCGCTTCAGCGGCCGCAGCAGCTGCCGGCGGTGCCGGTGGAGCTGG
TGGCGAGTACGGTGGTGCTAACGCCGGTGCTGGTGCTCTCGAATCCGGAG
CCGATGCCGCCGGTGTGGCACAGGCTGGCCAGAGCAGCTACGGATCCGAC
CAGAACATTCCGTACAAGCCGGTGAACACCAAGGGTAACACCCTGACCTC
ATCGATCACCTACCCGCAGAACAAGGGCGAGATCCTCATCCATCGTCCCG
CTCCCATCATTGTCAAGCGTCCGCCCACCAAGGTGCTGGTGAACCATCCA
CCATTGGTGGTTAAGCCCGCTCCCGTGGTGCTCCACAAGCCCCCAGCAAT
CGTTCTCCGCAAGGTCTACGTCAAGCACCACCCACGTCGCGTCAAGGTTG
AGCCCGTGTTCGTCAATGTGGTCAAGCCCCCAGCAGAGAAGTACTTTGTC
AACGAGAACAAGCAGGGCTACGGACAGGGCTCGCAGTCCCACGGACACGG
CCATGGACACGGTGGCCATGGACACGGACACAGCGGACACGGACACGGTG
GACACGGTGCTGGACCCCATGGTCCTGGACCCCATGACGGTGGCCGTGCT
CTGCCCGCCTACGCTTCGGGAGCTGATTCCGCTGCCGCCAGCGCTGGCTA
TCAGCTGCTCCAGAGCGGCAACCAGGGTCTGTCCGCTCTTGCCAACATCG
CCGGCGAGCGTGAGGGTCCCTATGGTCCCGCTCCAAGCCATCAGCACTAT
AGCGCCGGTCCAGCCGGACATGGCGGCTATGCTGCTCCCGCCTATTAGGT
AACAGATGCGGAGGAGTTACGGATTGGATGACTGCTGCGGCTCCGGAATC
AACTGAAGCGGCTGGTTTAGTCATTCGCTTATCCGGCTGATTAGTTACTA
TGTTTTTTTTACAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP19603.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Cp38-RB 1422 Cp38-RB 174..1303 1..1130 5635 99.9 Plus
Cp38.a 1622 Cp38.a 174..1303 1..1130 5635 99.9 Plus
Cp38-RA 1285 Cp38-RA 174..1285 1..1112 5545 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8373968..8374957 123..1112 4950 100 Plus
chrX 22417052 chrX 8373620..8373742 1..123 600 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8482185..8483192 123..1130 5040 100 Plus
X 23542271 X 8481837..8481959 1..123 600 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8490283..8491290 123..1130 5040 100 Plus
X 23527363 X 8489935..8490057 1..123 600 99.1 Plus
Blast to na_te.dros performed 2019-03-16 22:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 910..984 287..211 110 62.3 Minus

IP19603.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:06:55 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8373620..8373741 1..122 99 -> Plus
chrX 8373968..8374947 123..1102 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:15:21 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RB 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:03:10 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RB 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:39 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:48:32 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:45 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:52:18 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RB 1..1112 1..1112 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:03:10 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RB 1..1112 1..1112 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:39 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RA 1..1112 1..1112 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:48:32 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:45 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
Cp38-RA 1..1112 1..1112 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:06:55 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
X 8481837..8481958 1..122 99 -> Plus
X 8482185..8483174 123..1112 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:06:55 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
X 8481837..8481958 1..122 99 -> Plus
X 8482185..8483174 123..1112 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:06:55 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
X 8481837..8481958 1..122 99 -> Plus
X 8482185..8483174 123..1112 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:39 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8375870..8375991 1..122 99 -> Plus
arm_X 8376218..8377207 123..1112 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:55:10 Download gff for IP19603.complete
Subject Subject Range Query Range Percent Splice Strand
X 8490283..8491272 123..1112 100   Plus
X 8489935..8490056 1..122 99 -> Plus

IP19603.hyp Sequence

Translation from 2 to 997

> IP19603.hyp
QKTADSPSGSTPEAEEQLELQLGDKMTRSTYIWALAACLIACASANYGSS
QGYGPESGSGASDGGADAASAAAAAAGGAGGAGGEYGGANAGAGALESGA
DAAGVAQAGQSSYGSDQNIPYKPVNTKGNTLTSSITYPQNKGEILIHRPA
PIIVKRPPTKVLVNHPPLVVKPAPVVLHKPPAIVLRKVYVKHHPRRVKVE
PVFVNVVKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGG
HGAGPHGPGPHDGGRALPAYASGADSAAASAGYQLLQSGNQGLSALANIA
GEREGPYGPAPSHQHYSAGPAGHGGYAAPAY*

IP19603.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cp38-PB 306 CG11213-PB 1..306 26..331 1648 100 Plus
Cp38-PA 306 CG11213-PA 1..306 26..331 1648 100 Plus

IP19603.pep Sequence

Translation from 77 to 997

> IP19603.pep
MTRSTYIWALAACLIACASANYGSSQGYGPESGSGASDGGADAASAAAAA
AGGAGGAGGEYGGANAGAGALESGADAAGVAQAGQSSYGSDQNIPYKPVN
TKGNTLTSSITYPQNKGEILIHRPAPIIVKRPPTKVLVNHPPLVVKPAPV
VLHKPPAIVLRKVYVKHHPRRVKVEPVFVNVVKPPAEKYFVNENKQGYGQ
GSQSHGHGHGHGGHGHGHSGHGHGGHGAGPHGPGPHDGGRALPAYASGAD
SAAASAGYQLLQSGNQGLSALANIAGEREGPYGPAPSHQHYSAGPAGHGG
YAAPAY*

IP19603.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22371-PA 312 GF22371-PA 85..294 76..289 746 85 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18257-PA 302 GG18257-PA 1..302 1..306 964 92.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12241-PA 295 GH12241-PA 1..280 1..283 780 69.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Cp38-PB 306 CG11213-PB 1..306 1..306 1648 100 Plus
Cp38-PA 306 CG11213-PA 1..306 1..306 1648 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15775-PA 299 GI15775-PA 1..281 1..283 792 69.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20318-PA 303 GL20318-PA 66..269 78..279 665 83.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10847-PA 324 GA10847-PA 1..290 1..279 705 73.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21647-PA 214 GM21647-PA 4..214 79..306 537 78.5 Plus
Dsec\GM21636-PA 64 GM21636-PA 1..62 1..62 292 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18632-PA 304 GJ18632-PA 88..304 78..306 802 79 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19993-PA 299 GK19993-PA 1..299 1..306 683 69.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15787-PA 307 GE15787-PA 1..307 1..306 1497 98 Plus