Clone IP19624 Report

Search the DGRC for IP19624

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:196
Well:24
Vector:pOTB7_DraIII
Associated Gene/TranscriptCp7Fc-RA
Protein status:IP19624.pep: gold
Sequenced Size:1159

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cp7Fc 2008-04-29 Release 5.5 accounting
Cp7Fc 2008-05-05 Release 5.5 slip selected
Cp7Fc 2008-08-15 Release 5.9 accounting
Cp7Fc 2008-12-18 5.12 accounting

Clone Sequence Records

IP19624.complete Sequence

1159 bp assembled on 2007-11-15

GenBank Submission: BT031227

> IP19624.complete
CTCGGTCGAAATGGCAGCCGACGGCAGTTGGCCTATACTACTCTTGTTGG
TCTCAACACAGGCCATTATTCACGCTGAGAATCTAAGTGAATCCACGCCC
GGCCCCGATGAGGAATACAATGTGAGCACAACTCCGGGTGCGCCGCTGGA
AGAGACCACCAATCGCTTGGCTGCTCGCGTTGAGCCATACGATAAGGGTG
ATCGGGAGCAGTACGATGTGATCGATGTGGCCACAGCTACCGGTACGGTG
ATGGGCAAGCCCAGAAGTGGACAGACCACGAGAATCTACACCACCGGCGA
AGTGGACGAAAGCTTTTGGCTAAAGCATCTTGGCGATGACTTCAAACATG
CCATCCATCTGCAGGTGGGCGGCACCAACGAAGAGTACAATCGCCTGATT
AACCGGACCCAGAACGGTGTCCACGAGGAGGTGCATCACGAGTATTTACC
GGGGGCCGAACGACCTGGCAGCGCAGTCCAGCCTCCGTCTCCTCTACCTG
CGCCACACCAATCGCGTCCAGCTTATCGTCAGGGTTTCGACAATCGAGCC
ATGGCCATGAAACAGCAGTATCTCATCCATCAGCAGACCCAGCAATCGCA
TCCTGCCCAGCAACGCTATAACTATGCCCAACAGCATGCACAACACTATG
CACCACAACCACAACTGCAACCGCAACCACAACCACAACCACAATACCCA
CAGCACACACCGCACAGAAACACGTATGCAATGCCTCAGAATTATGGGCA
GCAGAACTACAAGCCGCAGAGTTATATTATCAACTCTAGCGAAGATCAGC
TGCACGCCGAGCAATCGAATCCCTCGCCAATGAAATCAGCTGGAGAGGAT
CGACAACATCACGAGGAGGAGTTTGACTCCTTTGGCGGTCAGCTCAACTT
CAAATCACCCTTCAATGACTACGGCAGTCGACCAGCACGAGATCTCACCT
ACCTTCTTTATAAGCGGGGTCTTTAGAAGCTAAATCCATGTCCACGTCAA
ACCAAAGATTTGCGGTCTCCAGACCATTGAGTTCTATAAATGGGACTGAG
CCACACCATACACCACACACCACACATACACACACGCCAACACATTACAC
ACAACACGAACTACACAAACACTGAGATTAAGAAAAAAAAAAAAAAAAAA
AAAAAAAAA

IP19624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fc-RA 1213 Cp7Fc-RA 61..1209 1..1149 5595 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8369042..8370096 78..1132 5215 99.6 Plus
chrX 22417052 chrX 8368893..8368971 1..79 380 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8477266..8478345 78..1157 5235 99 Plus
X 23542271 X 8477117..8477195 1..79 380 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8485364..8486443 78..1157 5235 98.9 Plus
X 23527363 X 8485215..8485293 1..79 380 98.7 Plus
Blast to na_te.dros performed on 2019-03-16 22:05:54 has no hits.

IP19624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:06:57 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8368893..8368971 1..79 98 -> Plus
chrX 8369044..8370096 80..1132 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:15:33 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..966 11..976 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:03:14 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..966 11..976 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:42 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..966 11..976 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:48:35 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..966 11..976 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:47 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..966 11..976 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:52:32 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..1132 1..1132 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:03:14 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..1132 1..1132 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:42 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..1132 1..1132 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:48:35 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..966 11..976 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:47 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fc-RA 1..1132 1..1132 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:06:57 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
X 8477117..8477195 1..79 98 -> Plus
X 8477268..8478320 80..1132 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:06:57 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
X 8477117..8477195 1..79 98 -> Plus
X 8477268..8478320 80..1132 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:06:57 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
X 8477117..8477195 1..79 98 -> Plus
X 8477268..8478320 80..1132 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:42 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8371150..8371228 1..79 98 -> Plus
arm_X 8371301..8372353 80..1132 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:55:14 Download gff for IP19624.complete
Subject Subject Range Query Range Percent Splice Strand
X 8485366..8486418 80..1132 99   Plus
X 8485215..8485293 1..79 98 -> Plus

IP19624.hyp Sequence

Translation from 0 to 975

> IP19624.hyp
SVEMAADGSWPILLLLVSTQAIIHAENLSESTPGPDEEYNVSTTPGAPLE
ETTNRLAARVEPYDKGDREQYDVIDVATATGTVMGKPRSGQTTRIYTTGE
VDESFWLKHLGDDFKHAIHLQVGGTNEEYNRLINRTQNGVHEEVHHEYLP
GAERPGSAVQPPSPLPAPHQSRPAYRQGFDNRAMAMKQQYLIHQQTQQSH
PAQQRYNYAQQHAQHYAPQPQLQPQPQPQPQYPQHTPHRNTYAMPQNYGQ
QNYKPQSYIINSSEDQLHAEQSNPSPMKSAGEDRQHHEEEFDSFGGQLNF
KSPFNDYGSRPARDLTYLLYKRGL*

IP19624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fc-PA 321 CG15351-PA 1..321 4..324 1739 100 Plus

IP19624.pep Sequence

Translation from 10 to 975

> IP19624.pep
MAADGSWPILLLLVSTQAIIHAENLSESTPGPDEEYNVSTTPGAPLEETT
NRLAARVEPYDKGDREQYDVIDVATATGTVMGKPRSGQTTRIYTTGEVDE
SFWLKHLGDDFKHAIHLQVGGTNEEYNRLINRTQNGVHEEVHHEYLPGAE
RPGSAVQPPSPLPAPHQSRPAYRQGFDNRAMAMKQQYLIHQQTQQSHPAQ
QRYNYAQQHAQHYAPQPQLQPQPQPQPQYPQHTPHRNTYAMPQNYGQQNY
KPQSYIINSSEDQLHAEQSNPSPMKSAGEDRQHHEEEFDSFGGQLNFKSP
FNDYGSRPARDLTYLLYKRGL*

IP19624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22369-PA 322 GF22369-PA 1..322 1..321 802 56.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18254-PA 328 GG18254-PA 1..328 1..321 1332 82.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12239-PA 431 GH12239-PA 97..184 68..155 395 76.1 Plus
Dgri\GH12239-PA 431 GH12239-PA 350..431 242..321 192 56.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fc-PA 321 CG15351-PA 1..321 1..321 1739 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15773-PA 377 GI15773-PA 65..377 54..321 542 43.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20316-PA 328 GL20316-PA 23..328 20..321 660 50.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13663-PA 367 GA13663-PA 23..367 20..321 685 49.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21616-PA 315 GM21616-PA 1..315 1..321 1491 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16903-PA 313 GD16903-PA 1..313 1..321 1606 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18630-PA 376 GJ18630-PA 88..376 57..321 514 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19991-PA 306 GK19991-PA 88..172 63..151 363 75.3 Plus
Dwil\GK19991-PA 306 GK19991-PA 222..306 252..321 160 48.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15785-PA 326 GE15785-PA 1..326 1..321 1361 83.7 Plus