Clone IP19808 Report

Search the DGRC for IP19808

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:8
Vector:pOT2
Associated Gene/TranscriptCG34039-RB
Protein status:IP19808.pep: gold
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34039 2008-04-29 Release 5.5 accounting
CG34039 2008-05-05 Release 5.5 slip selected
CG34039 2008-08-15 Release 5.9 accounting
CG34039 2008-12-18 5.12 accounting

Clone Sequence Records

IP19808.complete Sequence

696 bp assembled on 2008-05-22

GenBank Submission: BT030902

> IP19808.complete
CTTCAGCAAGCAAAAATTAAAAACATTAGATTAGAAAATCCCCAACAAAT
AAAGACAGCACTAAAATGAAATTCCGCTTCTGTGGCGAAGGCGATTGCCC
CGATTGGGTCCTAGCTGAGATCATATCAACACTCTCGAACTTGAGCATTG
AAAACTTGGAACAACTTAGCGATTTAGTGGCACAACGAATTTGTGGAGAG
ACATTTGAGGAAGCGAAAATAAAATCGCTGACATCCACATTAACTAATGA
AGGAAAAACCGCCGTGGCATGCATCAATTTTATGCTGACCAGCGCAGCTC
GCTATAGCTGTAGTGAAAGCATTTTTGGCGAGGAGATCCAGCAATTGGGA
CTTCCCAAGGACCATGCCGCAGCCATGTGCAGAGTCCTCCAAAAGCATTC
CGCCACCATAAGGCAAACACTTATAAACAAATCTTTCAGAATTAACGAAC
TGACAAGCGTCCGAGACATATCTACGCCAGGGCAAACGCCTCCAAACTAC
GCCACCTTGGAACTGAAGATCTCGCAAGAACTGGTCGATGGCCTACCGAA
GGATACCACCCATGTCCTCAACATTGATCGCACCCAAATGAAGGCTCTGC
TGGCGGAGCTGAAATTGGCACGTGATGTTATGCAAAAATATGAAAATAAA
CCAGATTCCTAAAAATGTTATTAATACTAAAAAAAAAAAAAAAAAA

IP19808.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34039-RB 931 CG34039-RB 89..769 1..681 3405 100 Plus
CG34039-RC 680 CG34039-RC 9..680 7..678 3360 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14552484..14552720 442..678 1170 99.6 Plus
chr3L 24539361 chr3L 14552153..14552390 204..441 1160 99.2 Plus
chr3L 24539361 chr3L 14551965..14552107 68..210 715 100 Plus
chr3L 24539361 chr3L 14550130..14550197 1..68 340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14562377..14562616 442..681 1200 100 Plus
3L 28110227 3L 14562046..14562283 204..441 1175 99.6 Plus
3L 28110227 3L 14561858..14562000 68..210 715 100 Plus
3L 28110227 3L 14560021..14560088 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14555477..14555716 442..681 1200 100 Plus
3L 28103327 3L 14555146..14555383 204..441 1175 99.5 Plus
3L 28103327 3L 14554958..14555100 68..210 715 100 Plus
3L 28103327 3L 14553121..14553188 1..68 340 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:48:38 has no hits.

IP19808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:49:32 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14552484..14552720 442..678 99   Plus
chr3L 14550130..14550197 1..68 100 -> Plus
chr3L 14551966..14552106 69..209 100 -> Plus
chr3L 14552159..14552390 210..441 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:15:55 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RA 1..594 69..662 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:31 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RB 1..597 66..662 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:58:16 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RB 1..597 66..662 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:20 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RA 1..594 69..662 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:21:09 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RB 1..597 66..662 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:48 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RA 1..594 69..662 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:30 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RB 22..699 1..678 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:58:16 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RB 22..699 1..678 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:21 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RA 1..594 69..662 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:21:09 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34039-RB 22..699 1..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:32 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14560021..14560088 1..68 100 -> Plus
3L 14561859..14561999 69..209 100 -> Plus
3L 14562052..14562283 210..441 100 -> Plus
3L 14562377..14562613 442..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:32 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14560021..14560088 1..68 100 -> Plus
3L 14561859..14561999 69..209 100 -> Plus
3L 14562052..14562283 210..441 100 -> Plus
3L 14562377..14562613 442..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:49:32 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14560021..14560088 1..68 100 -> Plus
3L 14561859..14561999 69..209 100 -> Plus
3L 14562052..14562283 210..441 100 -> Plus
3L 14562377..14562613 442..678 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:58:16 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14553121..14553188 1..68 100 -> Plus
arm_3L 14554959..14555099 69..209 100 -> Plus
arm_3L 14555152..14555383 210..441 100 -> Plus
arm_3L 14555477..14555713 442..678 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:05 Download gff for IP19808.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14555477..14555713 442..678 100   Plus
3L 14555152..14555383 210..441 100 -> Plus
3L 14553121..14553188 1..68 100 -> Plus
3L 14554959..14555099 69..209 100 -> Plus

IP19808.pep Sequence

Translation from 65 to 661

> IP19808.pep
MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEA
KIKSLTSTLTNEGKTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDH
AAAMCRVLQKHSATIRQTLINKSFRINELTSVRDISTPGQTPPNYATLEL
KISQELVDGLPKDTTHVLNIDRTQMKALLAELKLARDVMQKYENKPDS*

IP19808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24607-PA 200 GF24607-PA 5..198 2..195 892 84 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15685-PA 204 GG15685-PA 8..204 2..198 1012 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14750-PA 209 GH14750-PA 13..206 2..195 810 75.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG34039-PB 198 CG34039-PB 1..198 1..198 1006 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11491-PA 203 GI11491-PA 7..200 2..195 800 73.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21017-PA 202 GL21017-PA 10..202 2..194 883 82.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23804-PA 202 GA23804-PA 10..202 2..194 886 82.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25469-PA 204 GM25469-PA 8..204 2..198 1027 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14492-PA 197 GD14492-PA 1..197 2..198 1018 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13685-PA 202 GJ13685-PA 6..202 2..198 833 74.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10524-PA 205 GK10524-PA 8..201 2..195 819 76.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22016-PA 204 GE22016-PA 8..204 2..198 1001 94.4 Plus

IP19808.hyp Sequence

Translation from 65 to 661

> IP19808.hyp
MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEA
KIKSLTSTLTNEGKTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDH
AAAMCRVLQKHSATIRQTLINKSFRINELTSVRDISTPGQTPPNYATLEL
KISQELVDGLPKDTTHVLNIDRTQMKALLAELKLARDVMQKYENKPDS*

IP19808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34039-PB 198 CG34039-PB 1..198 1..198 1006 100 Plus