BDGP Sequence Production Resources |
Search the DGRC for IP19808
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 198 |
Well: | 8 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34039-RB |
Protein status: | IP19808.pep: gold |
Sequenced Size: | 696 |
Gene | Date | Evidence |
---|---|---|
CG34039 | 2008-04-29 | Release 5.5 accounting |
CG34039 | 2008-05-05 | Release 5.5 slip selected |
CG34039 | 2008-08-15 | Release 5.9 accounting |
CG34039 | 2008-12-18 | 5.12 accounting |
696 bp assembled on 2008-05-22
GenBank Submission: BT030902
> IP19808.complete CTTCAGCAAGCAAAAATTAAAAACATTAGATTAGAAAATCCCCAACAAAT AAAGACAGCACTAAAATGAAATTCCGCTTCTGTGGCGAAGGCGATTGCCC CGATTGGGTCCTAGCTGAGATCATATCAACACTCTCGAACTTGAGCATTG AAAACTTGGAACAACTTAGCGATTTAGTGGCACAACGAATTTGTGGAGAG ACATTTGAGGAAGCGAAAATAAAATCGCTGACATCCACATTAACTAATGA AGGAAAAACCGCCGTGGCATGCATCAATTTTATGCTGACCAGCGCAGCTC GCTATAGCTGTAGTGAAAGCATTTTTGGCGAGGAGATCCAGCAATTGGGA CTTCCCAAGGACCATGCCGCAGCCATGTGCAGAGTCCTCCAAAAGCATTC CGCCACCATAAGGCAAACACTTATAAACAAATCTTTCAGAATTAACGAAC TGACAAGCGTCCGAGACATATCTACGCCAGGGCAAACGCCTCCAAACTAC GCCACCTTGGAACTGAAGATCTCGCAAGAACTGGTCGATGGCCTACCGAA GGATACCACCCATGTCCTCAACATTGATCGCACCCAAATGAAGGCTCTGC TGGCGGAGCTGAAATTGGCACGTGATGTTATGCAAAAATATGAAAATAAA CCAGATTCCTAAAAATGTTATTAATACTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 14552484..14552720 | 442..678 | 1170 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 14552153..14552390 | 204..441 | 1160 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 14551965..14552107 | 68..210 | 715 | 100 | Plus |
chr3L | 24539361 | chr3L | 14550130..14550197 | 1..68 | 340 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 14562377..14562616 | 442..681 | 1200 | 100 | Plus |
3L | 28110227 | 3L | 14562046..14562283 | 204..441 | 1175 | 99.6 | Plus |
3L | 28110227 | 3L | 14561858..14562000 | 68..210 | 715 | 100 | Plus |
3L | 28110227 | 3L | 14560021..14560088 | 1..68 | 340 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 14555477..14555716 | 442..681 | 1200 | 100 | Plus |
3L | 28103327 | 3L | 14555146..14555383 | 204..441 | 1175 | 99.5 | Plus |
3L | 28103327 | 3L | 14554958..14555100 | 68..210 | 715 | 100 | Plus |
3L | 28103327 | 3L | 14553121..14553188 | 1..68 | 340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 14552484..14552720 | 442..678 | 99 | Plus | |
chr3L | 14550130..14550197 | 1..68 | 100 | -> | Plus |
chr3L | 14551966..14552106 | 69..209 | 100 | -> | Plus |
chr3L | 14552159..14552390 | 210..441 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RA | 1..594 | 69..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RB | 1..597 | 66..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RB | 1..597 | 66..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RA | 1..594 | 69..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RB | 1..597 | 66..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RA | 1..594 | 69..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RB | 22..699 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RB | 22..699 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RA | 1..594 | 69..662 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34039-RB | 22..699 | 1..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14560021..14560088 | 1..68 | 100 | -> | Plus |
3L | 14561859..14561999 | 69..209 | 100 | -> | Plus |
3L | 14562052..14562283 | 210..441 | 100 | -> | Plus |
3L | 14562377..14562613 | 442..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14560021..14560088 | 1..68 | 100 | -> | Plus |
3L | 14561859..14561999 | 69..209 | 100 | -> | Plus |
3L | 14562052..14562283 | 210..441 | 100 | -> | Plus |
3L | 14562377..14562613 | 442..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14560021..14560088 | 1..68 | 100 | -> | Plus |
3L | 14561859..14561999 | 69..209 | 100 | -> | Plus |
3L | 14562052..14562283 | 210..441 | 100 | -> | Plus |
3L | 14562377..14562613 | 442..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 14553121..14553188 | 1..68 | 100 | -> | Plus |
arm_3L | 14554959..14555099 | 69..209 | 100 | -> | Plus |
arm_3L | 14555152..14555383 | 210..441 | 100 | -> | Plus |
arm_3L | 14555477..14555713 | 442..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14555477..14555713 | 442..678 | 100 | Plus | |
3L | 14555152..14555383 | 210..441 | 100 | -> | Plus |
3L | 14553121..14553188 | 1..68 | 100 | -> | Plus |
3L | 14554959..14555099 | 69..209 | 100 | -> | Plus |
Translation from 65 to 661
> IP19808.pep MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEA KIKSLTSTLTNEGKTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDH AAAMCRVLQKHSATIRQTLINKSFRINELTSVRDISTPGQTPPNYATLEL KISQELVDGLPKDTTHVLNIDRTQMKALLAELKLARDVMQKYENKPDS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24607-PA | 200 | GF24607-PA | 5..198 | 2..195 | 892 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15685-PA | 204 | GG15685-PA | 8..204 | 2..198 | 1012 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14750-PA | 209 | GH14750-PA | 13..206 | 2..195 | 810 | 75.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34039-PB | 198 | CG34039-PB | 1..198 | 1..198 | 1006 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11491-PA | 203 | GI11491-PA | 7..200 | 2..195 | 800 | 73.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21017-PA | 202 | GL21017-PA | 10..202 | 2..194 | 883 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23804-PA | 202 | GA23804-PA | 10..202 | 2..194 | 886 | 82.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25469-PA | 204 | GM25469-PA | 8..204 | 2..198 | 1027 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14492-PA | 197 | GD14492-PA | 1..197 | 2..198 | 1018 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13685-PA | 202 | GJ13685-PA | 6..202 | 2..198 | 833 | 74.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10524-PA | 205 | GK10524-PA | 8..201 | 2..195 | 819 | 76.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22016-PA | 204 | GE22016-PA | 8..204 | 2..198 | 1001 | 94.4 | Plus |
Translation from 65 to 661
> IP19808.hyp MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEA KIKSLTSTLTNEGKTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDH AAAMCRVLQKHSATIRQTLINKSFRINELTSVRDISTPGQTPPNYATLEL KISQELVDGLPKDTTHVLNIDRTQMKALLAELKLARDVMQKYENKPDS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34039-PB | 198 | CG34039-PB | 1..198 | 1..198 | 1006 | 100 | Plus |