BDGP Sequence Production Resources |
Search the DGRC for IP19829
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 198 |
Well: | 29 |
Vector: | pOT2 |
Associated Gene/Transcript | CG33290-RA |
Protein status: | IP19829.pep: gold |
Sequenced Size: | 673 |
Gene | Date | Evidence |
---|---|---|
CG33290 | 2008-04-29 | Release 5.5 accounting |
CG33290 | 2008-05-05 | Release 5.5 slip selected |
CG33290 | 2008-08-15 | Release 5.9 accounting |
CG33290 | 2008-12-18 | 5.12 accounting |
673 bp assembled on 2008-05-14
GenBank Submission: BT030906
> IP19829.complete AGAAGTTAGCTGCATTGGAGGCCACTAGAAATATTGCTAAAGAAAACTTT CAAAAAACTTTTTGGGCAACATGTTAAAGTTTCTTTGGCTTTTACCCATT GTCACTATCGCTATACCTAAAATTACCCACGCTCAAAGGCCGTCTTTTGC TGGCATAAGACCTCCAGGCGGACTTACTCAGAAGGACAAGTACGCCCAAA CTAAAAATACAGCCCTGGAGAACTTTAATGGAGTTTCGGGACCCAAGGAT ACTACGCAAAAGAAAATTATCAACCTTCCTTATGGAGCACCGCAAAGGCC GCCAATGGGAGTTCCGCTGGTTCATCCCTCCGCTCCGGAGGAGTTGTTAG CCTCGTACAGCCCCGTCAACAACGCTGCTGGATTTCCAGCTCAAACTGCC CCAGATAACAGCCGACTTCCCATCGATGCCCGAGGTGACAGGGACTGGGT GAATAGATTGAAGCAGCTGCCCGTGGACCAGCAGCCCTTCTGGCTTGTGA ACTATCAAGCAATCGAAGCAATGAGGAACAATCCCAGACCCAATGTTGGA AATTATGAATGGCGTGGGAATTCGTTCGGCGGTTAAAAACTTTGAAGGTT TCTTAATTTTTAATATAAACATCATTAAGAATAAAAAGCTTCAGGATGTC TTTTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 21531294..21531947 | 1..654 | 3270 | 100 | Plus |
chr3L | 24539361 | chr3L | 21725225..21725285 | 518..458 | 185 | 86.9 | Minus |
chr3L | 24539361 | chr3L | 21726790..21726864 | 493..419 | 180 | 82.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 21542359..21543013 | 1..655 | 3275 | 100 | Plus |
3L | 28110227 | 3L | 21736290..21736350 | 518..458 | 185 | 86.9 | Minus |
3L | 28110227 | 3L | 21737855..21737929 | 493..419 | 180 | 82.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 21535459..21536113 | 1..655 | 3275 | 100 | Plus |
3L | 28103327 | 3L | 21729390..21729450 | 518..458 | 185 | 86.8 | Minus |
3L | 28103327 | 3L | 21730955..21731029 | 493..419 | 180 | 82.6 | Minus |
3L | 28103327 | 3L | 21731295..21731383 | 222..134 | 145 | 77.5 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy12 | 10218 | gypsy12 GYPSY12 10218bp | 4439..4497 | 25..83 | 124 | 67.8 | Plus |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 1909..1959 | 270..221 | 108 | 70.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21531294..21531947 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..516 | 71..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..516 | 71..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..516 | 71..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..516 | 71..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..516 | 71..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..516 | 71..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..654 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..654 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..516 | 71..586 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33290-RA | 1..654 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21542359..21543012 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21542359..21543012 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21542359..21543012 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21535459..21536112 | 1..654 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21535459..21536112 | 1..654 | 100 | Plus |
Translation from 70 to 585
> IP19829.pep MLKFLWLLPIVTIAIPKITHAQRPSFAGIRPPGGLTQKDKYAQTKNTALE NFNGVSGPKDTTQKKIINLPYGAPQRPPMGVPLVHPSAPEELLASYSPVN NAAGFPAQTAPDNSRLPIDARGDRDWVNRLKQLPVDQQPFWLVNYQAIEA MRNNPRPNVGNYEWRGNSFGG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24638-PA | 211 | GF24638-PA | 1..211 | 1..171 | 422 | 44.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16200-PA | 158 | GG16200-PA | 1..158 | 1..160 | 620 | 75.3 | Plus |
Dere\GG13204-PA | 194 | GG13204-PA | 1..194 | 1..171 | 454 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15093-PA | 234 | GH15093-PA | 1..124 | 1..118 | 229 | 44.8 | Plus |
Dgri\GH15093-PA | 234 | GH15093-PA | 179..234 | 116..171 | 213 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33290-PA | 171 | CG33290-PA | 1..171 | 1..171 | 923 | 100 | Plus |
CG14567-PA | 190 | CG14567-PA | 1..190 | 5..171 | 433 | 47.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13742-PA | 206 | GI13742-PA | 1..206 | 1..171 | 365 | 43.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25273-PA | 123 | GL25273-PA | 70..123 | 118..171 | 200 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13086-PA | 235 | GA13086-PA | 1..235 | 1..171 | 342 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22383-PA | 171 | GM22383-PA | 1..171 | 1..171 | 819 | 90.1 | Plus |
Dsec\GM22113-PA | 194 | GM22113-PA | 1..194 | 1..171 | 448 | 49.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14972-PA | 171 | GD14972-PA | 1..171 | 1..171 | 838 | 92.4 | Plus |
Dsim\GD12090-PA | 194 | GD12090-PA | 1..194 | 1..171 | 451 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14087-PA | 211 | GJ14087-PA | 2..211 | 4..171 | 363 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17123-PA | 224 | GK17123-PA | 168..223 | 115..170 | 210 | 64.3 | Plus |
Dwil\GK17123-PA | 224 | GK17123-PA | 4..80 | 19..87 | 201 | 58.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22298-PA | 193 | GE22298-PA | 1..193 | 1..171 | 427 | 50.5 | Plus |
Dyak\GE22984-PA | 193 | GE22984-PA | 1..193 | 1..171 | 410 | 48.5 | Plus |
Dyak\GE18000-PA | 96 | GE18000-PA | 1..90 | 1..88 | 311 | 68.9 | Plus |
Translation from 70 to 585
> IP19829.hyp MLKFLWLLPIVTIAIPKITHAQRPSFAGIRPPGGLTQKDKYAQTKNTALE NFNGVSGPKDTTQKKIINLPYGAPQRPPMGVPLVHPSAPEELLASYSPVN NAAGFPAQTAPDNSRLPIDARGDRDWVNRLKQLPVDQQPFWLVNYQAIEA MRNNPRPNVGNYEWRGNSFGG*