Clone IP19829 Report

Search the DGRC for IP19829

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:29
Vector:pOT2
Associated Gene/TranscriptCG33290-RA
Protein status:IP19829.pep: gold
Sequenced Size:673

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33290 2008-04-29 Release 5.5 accounting
CG33290 2008-05-05 Release 5.5 slip selected
CG33290 2008-08-15 Release 5.9 accounting
CG33290 2008-12-18 5.12 accounting

Clone Sequence Records

IP19829.complete Sequence

673 bp assembled on 2008-05-14

GenBank Submission: BT030906

> IP19829.complete
AGAAGTTAGCTGCATTGGAGGCCACTAGAAATATTGCTAAAGAAAACTTT
CAAAAAACTTTTTGGGCAACATGTTAAAGTTTCTTTGGCTTTTACCCATT
GTCACTATCGCTATACCTAAAATTACCCACGCTCAAAGGCCGTCTTTTGC
TGGCATAAGACCTCCAGGCGGACTTACTCAGAAGGACAAGTACGCCCAAA
CTAAAAATACAGCCCTGGAGAACTTTAATGGAGTTTCGGGACCCAAGGAT
ACTACGCAAAAGAAAATTATCAACCTTCCTTATGGAGCACCGCAAAGGCC
GCCAATGGGAGTTCCGCTGGTTCATCCCTCCGCTCCGGAGGAGTTGTTAG
CCTCGTACAGCCCCGTCAACAACGCTGCTGGATTTCCAGCTCAAACTGCC
CCAGATAACAGCCGACTTCCCATCGATGCCCGAGGTGACAGGGACTGGGT
GAATAGATTGAAGCAGCTGCCCGTGGACCAGCAGCCCTTCTGGCTTGTGA
ACTATCAAGCAATCGAAGCAATGAGGAACAATCCCAGACCCAATGTTGGA
AATTATGAATGGCGTGGGAATTCGTTCGGCGGTTAAAAACTTTGAAGGTT
TCTTAATTTTTAATATAAACATCATTAAGAATAAAAAGCTTCAGGATGTC
TTTTAAAAAAAAAAAAAAAAAAA

IP19829.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG33290-RA 654 CG33290-RA 1..654 1..654 3270 100 Plus
CG14567-RA 573 CG14567-RA 406..480 419..493 180 82.6 Plus
CG14567-RA 573 CG14567-RA 52..140 134..222 145 77.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21531294..21531947 1..654 3270 100 Plus
chr3L 24539361 chr3L 21725225..21725285 518..458 185 86.9 Minus
chr3L 24539361 chr3L 21726790..21726864 493..419 180 82.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21542359..21543013 1..655 3275 100 Plus
3L 28110227 3L 21736290..21736350 518..458 185 86.9 Minus
3L 28110227 3L 21737855..21737929 493..419 180 82.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21535459..21536113 1..655 3275 100 Plus
3L 28103327 3L 21729390..21729450 518..458 185 86.8 Minus
3L 28103327 3L 21730955..21731029 493..419 180 82.6 Minus
3L 28103327 3L 21731295..21731383 222..134 145 77.5 Minus
Blast to na_te.dros performed 2019-03-15 18:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy12 10218 gypsy12 GYPSY12 10218bp 4439..4497 25..83 124 67.8 Plus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 1909..1959 270..221 108 70.6 Minus

IP19829.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:40:13 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21531294..21531947 1..654 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:12 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:53:47 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:37 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:53:03 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:23 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:16:54 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:53:47 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:37 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..654 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:53:03 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..516 71..586 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:23 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
CG33290-RA 1..654 1..654 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:13 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21542359..21543012 1..654 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:13 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21542359..21543012 1..654 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:13 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21542359..21543012 1..654 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:37 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21535459..21536112 1..654 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:31:18 Download gff for IP19829.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21535459..21536112 1..654 100   Plus

IP19829.pep Sequence

Translation from 70 to 585

> IP19829.pep
MLKFLWLLPIVTIAIPKITHAQRPSFAGIRPPGGLTQKDKYAQTKNTALE
NFNGVSGPKDTTQKKIINLPYGAPQRPPMGVPLVHPSAPEELLASYSPVN
NAAGFPAQTAPDNSRLPIDARGDRDWVNRLKQLPVDQQPFWLVNYQAIEA
MRNNPRPNVGNYEWRGNSFGG*

IP19829.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24638-PA 211 GF24638-PA 1..211 1..171 422 44.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16200-PA 158 GG16200-PA 1..158 1..160 620 75.3 Plus
Dere\GG13204-PA 194 GG13204-PA 1..194 1..171 454 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15093-PA 234 GH15093-PA 1..124 1..118 229 44.8 Plus
Dgri\GH15093-PA 234 GH15093-PA 179..234 116..171 213 66.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG33290-PA 171 CG33290-PA 1..171 1..171 923 100 Plus
CG14567-PA 190 CG14567-PA 1..190 5..171 433 47.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13742-PA 206 GI13742-PA 1..206 1..171 365 43.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25273-PA 123 GL25273-PA 70..123 118..171 200 63 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13086-PA 235 GA13086-PA 1..235 1..171 342 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22383-PA 171 GM22383-PA 1..171 1..171 819 90.1 Plus
Dsec\GM22113-PA 194 GM22113-PA 1..194 1..171 448 49.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14972-PA 171 GD14972-PA 1..171 1..171 838 92.4 Plus
Dsim\GD12090-PA 194 GD12090-PA 1..194 1..171 451 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14087-PA 211 GJ14087-PA 2..211 4..171 363 44 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17123-PA 224 GK17123-PA 168..223 115..170 210 64.3 Plus
Dwil\GK17123-PA 224 GK17123-PA 4..80 19..87 201 58.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22298-PA 193 GE22298-PA 1..193 1..171 427 50.5 Plus
Dyak\GE22984-PA 193 GE22984-PA 1..193 1..171 410 48.5 Plus
Dyak\GE18000-PA 96 GE18000-PA 1..90 1..88 311 68.9 Plus

IP19829.hyp Sequence

Translation from 70 to 585

> IP19829.hyp
MLKFLWLLPIVTIAIPKITHAQRPSFAGIRPPGGLTQKDKYAQTKNTALE
NFNGVSGPKDTTQKKIINLPYGAPQRPPMGVPLVHPSAPEELLASYSPVN
NAAGFPAQTAPDNSRLPIDARGDRDWVNRLKQLPVDQQPFWLVNYQAIEA
MRNNPRPNVGNYEWRGNSFGG*

IP19829.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG33290-PA 171 CG33290-PA 1..171 1..171 923 100 Plus
CG14567-PA 190 CG14567-PA 1..190 5..171 433 47.4 Plus