Clone IP19832 Report

Search the DGRC for IP19832

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:32
Vector:pOT2
Associated Gene/TranscriptCG34008-RA
Protein status:IP19832.pep: gold
Sequenced Size:707

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34008 2008-04-29 Release 5.5 accounting
CG34008 2008-05-05 Release 5.5 slip selected
CG34008 2008-08-15 Release 5.9 accounting
CG34008 2008-12-18 5.12 accounting

Clone Sequence Records

IP19832.complete Sequence

707 bp assembled on 2008-05-14

GenBank Submission: BT030907

> IP19832.complete
ATTAACAATGTTTTTAAACGATATAGGCCAGCCCTTAATACTGGAAAAAG
GAAAAGTCTACAGTTCCTACGAGGAGCACCGTGGACCCTTGCTCTTCACG
TCAGCCGCCTTAGGAGATCTAATAGCACCACAAAATTGGTGCCAGTTAGC
TGTGGGTTCGCAGCTGGACATCTCACGGCTGCAATCACATGCAGATGTTT
CAGAAAGCTGCACTTTTGAAATACTACTGCCGAATAAGCCCACCCGACTA
GTGTACGATGAAAACGAGATCACAATCACATTGATACCAGCAGGAAGAAA
GGAAAACGGCTTGGAGTGCAACCTATTCTACATAGAAAACGGCCATGCAC
GATATTTAATTGTGGACTGCCTATCTGGGTATCTGGACTTTCTGCCAAAG
GCTTCGGGCTCCCTTCACACGGGCCTCTGTCAGGGAATCGATGTACTGTA
CGTGGACGAAGAGCTATTAGCTGAGAACCAAATAAACGAGGATCTTTACA
GTTTGGTTGACCTGATAAGACCAAAGTTCATATACGGGTTGCGGCAGTGG
GAACTGCCGAAGTGGCTGCTCGATCTGCGTCAGATTGATGATAGAAATAA
GAAGTATAGCGTGCTTTCCGTACAAAATGATGCATTTAAGGTTTAAAACA
AACGACCAGTAAACAGTCAAATAAAATCTAACTAAGACTAAAAAAAAAAA
AAAAAAA

IP19832.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34008-RA 851 CG34008-RA 131..820 1..690 3450 100 Plus
Srp14-RB 621 Srp14-RB 510..621 690..579 560 100 Minus
Srp14-RC 689 Srp14-RC 578..689 690..579 560 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16404608..16404958 689..339 1755 100 Minus
chr3R 27901430 chr3R 16405027..16405290 338..75 1320 100 Minus
chr3R 27901430 chr3R 16405346..16405421 76..1 380 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20580693..20581044 690..339 1760 100 Minus
3R 32079331 3R 20581113..20581376 338..75 1320 100 Minus
3R 32079331 3R 20581432..20581507 76..1 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20321524..20321875 690..339 1760 100 Minus
3R 31820162 3R 20321944..20322207 338..75 1320 100 Minus
3R 31820162 3R 20322263..20322338 76..1 380 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:27:46 has no hits.

IP19832.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:28:47 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16405027..16405288 77..338 100 <- Minus
chr3R 16405346..16405421 1..76 100   Minus
chr3R 16404608..16404958 339..689 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:15 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:50:31 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:01:37 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:49:48 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:10:01 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:13:21 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:50:31 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 16..704 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:01:37 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 16..704 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:49:48 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:10:01 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
CG34008-RA 16..704 1..689 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:28:47 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20581113..20581374 77..338 100 <- Minus
3R 20581432..20581507 1..76 100   Minus
3R 20580694..20581044 339..689 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:28:47 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20581113..20581374 77..338 100 <- Minus
3R 20581432..20581507 1..76 100   Minus
3R 20580694..20581044 339..689 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:28:47 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20581113..20581374 77..338 100 <- Minus
3R 20581432..20581507 1..76 100   Minus
3R 20580694..20581044 339..689 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:01:37 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16406835..16407096 77..338 100 <- Minus
arm_3R 16406416..16406766 339..689 100 <- Minus
arm_3R 16407154..16407229 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:29:03 Download gff for IP19832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20322263..20322338 1..76 100   Minus
3R 20321525..20321875 339..689 100 <- Minus
3R 20321944..20322205 77..338 100 <- Minus

IP19832.hyp Sequence

Translation from 0 to 645

> IP19832.hyp
LTMFLNDIGQPLILEKGKVYSSYEEHRGPLLFTSAALGDLIAPQNWCQLA
VGSQLDISRLQSHADVSESCTFEILLPNKPTRLVYDENEITITLIPAGRK
ENGLECNLFYIENGHARYLIVDCLSGYLDFLPKASGSLHTGLCQGIDVLY
VDEELLAENQINEDLYSLVDLIRPKFIYGLRQWELPKWLLDLRQIDDRNK
KYSVLSVQNDAFKV*

IP19832.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34008-PA 212 CG34008-PA 1..212 3..214 1110 100 Plus

IP19832.pep Sequence

Translation from 1 to 645

> IP19832.pep
LTMFLNDIGQPLILEKGKVYSSYEEHRGPLLFTSAALGDLIAPQNWCQLA
VGSQLDISRLQSHADVSESCTFEILLPNKPTRLVYDENEITITLIPAGRK
ENGLECNLFYIENGHARYLIVDCLSGYLDFLPKASGSLHTGLCQGIDVLY
VDEELLAENQINEDLYSLVDLIRPKFIYGLRQWELPKWLLDLRQIDDRNK
KYSVLSVQNDAFKV*

IP19832.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19940-PA 194 GF19940-PA 1..189 3..197 450 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15346-PA 212 GG15346-PA 1..212 3..214 960 86.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16179-PA 215 GH16179-PA 1..196 3..192 441 43.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34008-PA 212 CG34008-PA 1..212 3..214 1110 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22176-PA 213 GI22176-PA 1..196 3..192 479 49 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13927-PA 114 GL13927-PA 1..106 3..105 261 44.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26967-PA 206 GA26967-PA 1..193 3..192 534 51.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23180-PA 211 GM23180-PA 1..211 3..214 1013 92.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20053-PA 212 GD20053-PA 1..212 3..214 1008 91 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24296-PA 207 GJ24296-PA 1..196 3..192 480 49.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22716-PA 205 GK22716-PA 1..193 3..192 446 44.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25061-PA 212 GE25061-PA 1..212 3..214 898 80.2 Plus