Clone IP19834 Report

Search the DGRC for IP19834

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:34
Vector:pOT2
Associated Gene/TranscriptE(spl)malpha-BFM-RA
Protein status:IP19834.pep: gold
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
malpha 2008-04-29 Release 5.5 accounting
malpha 2008-05-05 Release 5.5 slip selected
malpha 2008-08-15 Release 5.9 accounting
malpha 2008-12-18 5.12 accounting

Clone Sequence Records

IP19834.complete Sequence

667 bp assembled on 2008-05-14

GenBank Submission: BT030909

> IP19834.complete
CAACACGCACTCTAAACAAAACTACCCACATAACTTCAACCAAAAATGTG
CCAACAAGTCGTTGTCGTCGCCAACACCAACAACAAGATGAAGACCAGCT
ACAGCATCAAGCAGGTCCTGAAGACGCTCTTCAAGAAGCAACAGAAGCAG
CAGCAGAAGCCTCAGGGATCTCTGGAATCGCTAGAATCCGTCGACAATCT
GCGCAACGCCCAGGTTGAGGAGGCCTACTATGCCGAGATCGATGAGAACG
CCGCCAACGAGAAGCTGGCCCAATTGGCTCACTCTCAGGAGTTCGAGATT
GTCGAGGAGCAGGAGGACGAGGAGGATGTCTATGTCCCAGTTCGCTTCGC
TCGCACCACCGCCGGCACCTTCTTCTGGACCACCAACCTTCAGCCAGTCG
CCAGCGTTGAGCCCGCCATGTGCTACTCCATGCAATTCCAGGATCGTTGG
GCCCAGGCTTAAGAATCCATTGCCTCAACCTTTGATCTTCAAGCTTTAAG
AACTCTACAAACATTGTGATAGCACCAGCGGCTTTAACTCCCCCAACAAT
CTCGGCGATCCAGCGCTTCCATTAGTTATTAAGATATTGTGATAAAACAA
AAAGAGCTTTAAAACACTCGTACAAAATACAAAACAAGAAATATCAAAAT
CAAAAAAAAAAAAAAAA

IP19834.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
malpha-RA 631 malpha-RA 9..631 1..623 3115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21833904..21834554 1..651 3255 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26010918..26011571 1..654 3270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25751749..25752402 1..654 3270 100 Plus
Blast to na_te.dros performed 2019-03-16 17:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2296..2395 55..155 133 60.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6785..6883 72..165 131 63.6 Plus
roo 9092 roo DM_ROO 9092bp 1070..1101 133..164 115 84.4 Plus

IP19834.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:49:58 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21833904..21834554 1..651 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:18 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
malpha-RA 1..417 46..462 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:42 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
malpha-RA 1..417 46..462 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:27 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)malpha-BFM-RA 1..417 46..462 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:57 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
malpha-RA 1..417 46..462 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:19:54 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)malpha-BFM-RA 1..417 46..462 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:43 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
malpha-RA 1..417 46..462 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:42 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
malpha-RA 26..676 1..651 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:27 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)malpha-BFM-RA 26..676 1..651 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:57 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
malpha-RA 1..417 46..462 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:19:54 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)malpha-BFM-RA 26..676 1..651 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:58 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26010918..26011568 1..651 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:58 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26010918..26011568 1..651 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:49:58 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26010918..26011568 1..651 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:27 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21836640..21837290 1..651 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:34 Download gff for IP19834.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25751749..25752399 1..651 100   Plus

IP19834.hyp Sequence

Translation from 45 to 461

> IP19834.hyp
MCQQVVVVANTNNKMKTSYSIKQVLKTLFKKQQKQQQKPQGSLESLESVD
NLRNAQVEEAYYAEIDENAANEKLAQLAHSQEFEIVEEQEDEEDVYVPVR
FARTTAGTFFWTTNLQPVASVEPAMCYSMQFQDRWAQA*

IP19834.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)malpha-BFM-PA 138 CG8337-PA 1..138 1..138 706 100 Plus
E(spl)m4-BFM-PA 152 CG6099-PA 1..152 1..138 217 39.8 Plus
Ocho-PB 149 CG3396-PB 11..149 10..138 161 36.5 Plus
Ocho-PC 149 CG3396-PC 11..149 10..138 161 36.5 Plus

IP19834.pep Sequence

Translation from 45 to 461

> IP19834.pep
MCQQVVVVANTNNKMKTSYSIKQVLKTLFKKQQKQQQKPQGSLESLESVD
NLRNAQVEEAYYAEIDENAANEKLAQLAHSQEFEIVEEQEDEEDVYVPVR
FARTTAGTFFWTTNLQPVASVEPAMCYSMQFQDRWAQA*

IP19834.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16797-PA 134 GF16797-PA 1..134 1..138 490 80.3 Plus
Dana\GF18223-PA 151 GF18223-PA 1..151 1..138 208 36.3 Plus
Dana\GF24626-PA 149 GF24626-PA 17..149 14..138 150 35.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11451-PA 143 GG11451-PA 1..143 1..138 689 95.1 Plus
Dere\GG12205-PA 152 GG12205-PA 1..152 1..138 213 39.8 Plus
Dere\GG15705-PA 226 GG15705-PA 86..226 10..138 157 36.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19453-PA 146 GH19453-PA 1..146 1..138 444 71.7 Plus
Dgri\GH18146-PA 156 GH18146-PA 1..156 1..138 222 40.1 Plus
Dgri\GH14634-PA 158 GH14634-PA 35..158 21..138 155 35.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)malpha-BFM-PA 138 CG8337-PA 1..138 1..138 706 100 Plus
E(spl)m4-BFM-PA 152 CG6099-PA 1..152 1..138 217 39.8 Plus
Ocho-PB 149 CG3396-PB 11..149 10..138 161 36.5 Plus
Ocho-PC 149 CG3396-PC 11..149 10..138 161 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24687-PA 132 GI24687-PA 1..132 15..138 420 71.7 Plus
Dmoj\GI22908-PA 156 GI22908-PA 1..156 1..138 218 39.5 Plus
Dmoj\GI11347-PA 162 GI11347-PA 40..162 21..138 159 34.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21817-PA 143 GL21817-PA 1..143 1..138 560 83.3 Plus
Dper\GL22019-PA 156 GL22019-PA 1..156 1..138 196 39.3 Plus
Dper\GL24664-PA 150 GL24664-PA 11..150 11..138 156 35.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21000-PA 143 GA21000-PA 1..143 1..138 560 83.3 Plus
Dpse\GA19352-PA 156 GA19352-PA 1..156 1..138 196 39.3 Plus
Dpse\GA17423-PA 151 GA17423-PA 11..151 10..138 161 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10295-PA 140 GM10295-PA 1..140 1..138 704 97.1 Plus
Dsec\GM10204-PA 152 GM10204-PA 1..152 1..138 210 39.1 Plus
Dsec\GM25493-PA 149 GM25493-PA 16..149 13..138 155 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\malpha-PA 140 GD21259-PA 1..140 1..138 704 97.1 Plus
Dsim\m4-PA 151 GD18154-PA 1..151 1..138 209 39.4 Plus
Dsim\GD14513-PA 149 GD14513-PA 16..149 13..138 155 35 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\malpha-PA 148 GJ23904-PA 1..148 1..138 428 70.1 Plus
Dvir\GJ23320-PA 156 GJ23320-PA 1..156 1..138 203 39.5 Plus
Dvir\GJ11601-PA 160 GJ11601-PA 39..160 21..138 139 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14456-PA 142 GK14456-PA 1..142 1..138 499 77.4 Plus
Dwil\GK12805-PA 150 GK12805-PA 21..150 16..138 194 39.4 Plus
Dwil\GK19004-PA 149 GK19004-PA 15..149 13..138 135 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\malpha-PA 144 GE23645-PA 1..144 1..138 686 93.8 Plus
Dyak\m4-PA 152 GE10649-PA 1..152 1..138 213 39.8 Plus
Dyak\GE22037-PA 149 GE22037-PA 16..149 13..138 154 35 Plus