BDGP Sequence Production Resources |
Search the DGRC for IP19834
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 198 |
Well: | 34 |
Vector: | pOT2 |
Associated Gene/Transcript | E(spl)malpha-BFM-RA |
Protein status: | IP19834.pep: gold |
Sequenced Size: | 667 |
Gene | Date | Evidence |
---|---|---|
malpha | 2008-04-29 | Release 5.5 accounting |
malpha | 2008-05-05 | Release 5.5 slip selected |
malpha | 2008-08-15 | Release 5.9 accounting |
malpha | 2008-12-18 | 5.12 accounting |
667 bp assembled on 2008-05-14
GenBank Submission: BT030909
> IP19834.complete CAACACGCACTCTAAACAAAACTACCCACATAACTTCAACCAAAAATGTG CCAACAAGTCGTTGTCGTCGCCAACACCAACAACAAGATGAAGACCAGCT ACAGCATCAAGCAGGTCCTGAAGACGCTCTTCAAGAAGCAACAGAAGCAG CAGCAGAAGCCTCAGGGATCTCTGGAATCGCTAGAATCCGTCGACAATCT GCGCAACGCCCAGGTTGAGGAGGCCTACTATGCCGAGATCGATGAGAACG CCGCCAACGAGAAGCTGGCCCAATTGGCTCACTCTCAGGAGTTCGAGATT GTCGAGGAGCAGGAGGACGAGGAGGATGTCTATGTCCCAGTTCGCTTCGC TCGCACCACCGCCGGCACCTTCTTCTGGACCACCAACCTTCAGCCAGTCG CCAGCGTTGAGCCCGCCATGTGCTACTCCATGCAATTCCAGGATCGTTGG GCCCAGGCTTAAGAATCCATTGCCTCAACCTTTGATCTTCAAGCTTTAAG AACTCTACAAACATTGTGATAGCACCAGCGGCTTTAACTCCCCCAACAAT CTCGGCGATCCAGCGCTTCCATTAGTTATTAAGATATTGTGATAAAACAA AAAGAGCTTTAAAACACTCGTACAAAATACAAAACAAGAAATATCAAAAT CAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
malpha-RA | 631 | malpha-RA | 9..631 | 1..623 | 3115 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 21833904..21834554 | 1..651 | 3255 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 26010918..26011571 | 1..654 | 3270 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 25751749..25752402 | 1..654 | 3270 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2296..2395 | 55..155 | 133 | 60.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6785..6883 | 72..165 | 131 | 63.6 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1070..1101 | 133..164 | 115 | 84.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 21833904..21834554 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
malpha-RA | 1..417 | 46..462 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
malpha-RA | 1..417 | 46..462 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
E(spl)malpha-BFM-RA | 1..417 | 46..462 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
malpha-RA | 1..417 | 46..462 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
E(spl)malpha-BFM-RA | 1..417 | 46..462 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
malpha-RA | 1..417 | 46..462 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
malpha-RA | 26..676 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
E(spl)malpha-BFM-RA | 26..676 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
malpha-RA | 1..417 | 46..462 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
E(spl)malpha-BFM-RA | 26..676 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26010918..26011568 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26010918..26011568 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26010918..26011568 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 21836640..21837290 | 1..651 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25751749..25752399 | 1..651 | 100 | Plus |
Translation from 45 to 461
> IP19834.hyp MCQQVVVVANTNNKMKTSYSIKQVLKTLFKKQQKQQQKPQGSLESLESVD NLRNAQVEEAYYAEIDENAANEKLAQLAHSQEFEIVEEQEDEEDVYVPVR FARTTAGTFFWTTNLQPVASVEPAMCYSMQFQDRWAQA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
E(spl)malpha-BFM-PA | 138 | CG8337-PA | 1..138 | 1..138 | 706 | 100 | Plus |
E(spl)m4-BFM-PA | 152 | CG6099-PA | 1..152 | 1..138 | 217 | 39.8 | Plus |
Ocho-PB | 149 | CG3396-PB | 11..149 | 10..138 | 161 | 36.5 | Plus |
Ocho-PC | 149 | CG3396-PC | 11..149 | 10..138 | 161 | 36.5 | Plus |
Translation from 45 to 461
> IP19834.pep MCQQVVVVANTNNKMKTSYSIKQVLKTLFKKQQKQQQKPQGSLESLESVD NLRNAQVEEAYYAEIDENAANEKLAQLAHSQEFEIVEEQEDEEDVYVPVR FARTTAGTFFWTTNLQPVASVEPAMCYSMQFQDRWAQA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16797-PA | 134 | GF16797-PA | 1..134 | 1..138 | 490 | 80.3 | Plus |
Dana\GF18223-PA | 151 | GF18223-PA | 1..151 | 1..138 | 208 | 36.3 | Plus |
Dana\GF24626-PA | 149 | GF24626-PA | 17..149 | 14..138 | 150 | 35.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11451-PA | 143 | GG11451-PA | 1..143 | 1..138 | 689 | 95.1 | Plus |
Dere\GG12205-PA | 152 | GG12205-PA | 1..152 | 1..138 | 213 | 39.8 | Plus |
Dere\GG15705-PA | 226 | GG15705-PA | 86..226 | 10..138 | 157 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19453-PA | 146 | GH19453-PA | 1..146 | 1..138 | 444 | 71.7 | Plus |
Dgri\GH18146-PA | 156 | GH18146-PA | 1..156 | 1..138 | 222 | 40.1 | Plus |
Dgri\GH14634-PA | 158 | GH14634-PA | 35..158 | 21..138 | 155 | 35.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
E(spl)malpha-BFM-PA | 138 | CG8337-PA | 1..138 | 1..138 | 706 | 100 | Plus |
E(spl)m4-BFM-PA | 152 | CG6099-PA | 1..152 | 1..138 | 217 | 39.8 | Plus |
Ocho-PB | 149 | CG3396-PB | 11..149 | 10..138 | 161 | 36.5 | Plus |
Ocho-PC | 149 | CG3396-PC | 11..149 | 10..138 | 161 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24687-PA | 132 | GI24687-PA | 1..132 | 15..138 | 420 | 71.7 | Plus |
Dmoj\GI22908-PA | 156 | GI22908-PA | 1..156 | 1..138 | 218 | 39.5 | Plus |
Dmoj\GI11347-PA | 162 | GI11347-PA | 40..162 | 21..138 | 159 | 34.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21817-PA | 143 | GL21817-PA | 1..143 | 1..138 | 560 | 83.3 | Plus |
Dper\GL22019-PA | 156 | GL22019-PA | 1..156 | 1..138 | 196 | 39.3 | Plus |
Dper\GL24664-PA | 150 | GL24664-PA | 11..150 | 11..138 | 156 | 35.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21000-PA | 143 | GA21000-PA | 1..143 | 1..138 | 560 | 83.3 | Plus |
Dpse\GA19352-PA | 156 | GA19352-PA | 1..156 | 1..138 | 196 | 39.3 | Plus |
Dpse\GA17423-PA | 151 | GA17423-PA | 11..151 | 10..138 | 161 | 35.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10295-PA | 140 | GM10295-PA | 1..140 | 1..138 | 704 | 97.1 | Plus |
Dsec\GM10204-PA | 152 | GM10204-PA | 1..152 | 1..138 | 210 | 39.1 | Plus |
Dsec\GM25493-PA | 149 | GM25493-PA | 16..149 | 13..138 | 155 | 35 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\malpha-PA | 140 | GD21259-PA | 1..140 | 1..138 | 704 | 97.1 | Plus |
Dsim\m4-PA | 151 | GD18154-PA | 1..151 | 1..138 | 209 | 39.4 | Plus |
Dsim\GD14513-PA | 149 | GD14513-PA | 16..149 | 13..138 | 155 | 35 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\malpha-PA | 148 | GJ23904-PA | 1..148 | 1..138 | 428 | 70.1 | Plus |
Dvir\GJ23320-PA | 156 | GJ23320-PA | 1..156 | 1..138 | 203 | 39.5 | Plus |
Dvir\GJ11601-PA | 160 | GJ11601-PA | 39..160 | 21..138 | 139 | 34.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14456-PA | 142 | GK14456-PA | 1..142 | 1..138 | 499 | 77.4 | Plus |
Dwil\GK12805-PA | 150 | GK12805-PA | 21..150 | 16..138 | 194 | 39.4 | Plus |
Dwil\GK19004-PA | 149 | GK19004-PA | 15..149 | 13..138 | 135 | 34.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\malpha-PA | 144 | GE23645-PA | 1..144 | 1..138 | 686 | 93.8 | Plus |
Dyak\m4-PA | 152 | GE10649-PA | 1..152 | 1..138 | 213 | 39.8 | Plus |
Dyak\GE22037-PA | 149 | GE22037-PA | 16..149 | 13..138 | 154 | 35 | Plus |