Clone IP19836 Report

Search the DGRC for IP19836

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:36
Vector:pOT2
Associated Gene/TranscriptCG34130-RA
Protein status:IP19836.pep: gold
Sequenced Size:992

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34130 2008-04-29 Release 5.5 accounting
CG34130 2008-05-05 Release 5.5 slip selected
CG34130 2008-08-15 Release 5.9 accounting
CG34130 2008-12-18 5.12 accounting

Clone Sequence Records

IP19836.complete Sequence

992 bp assembled on 2008-05-14

GenBank Submission: BT030910

> IP19836.complete
CTTAAACGCTTTATGTTATGAAATATATTCGGGAAATCTTTTCAATCGCT
CTTCTTCTGACAGAAGTCGGAGCTGCACACTCTAGTTGGTGGAATTCTTC
AGCCTCGTACTTGCATGGCAGGCCACCAGTGAGAACATTGAACAAGAATG
GAATTCGTCGAACCTCGGGTGGTCATGCGGTCCCTTGGCTATTAAGGATA
GTTGATGGACCTACTTTCGTCTGCGGAGCCTCGTACTTAAGTGCTTTGTA
TGCCCTCACCTCAGCAAACTGTATGCATAGTCATAGGTCACAGATGGAGT
CGCTCAGTGTGGAGTTGGTATCGTCGGACAGCCGGCAGGATAATCAGCTT
GATTCGCATGATCCTCCAAACGCCCTTATCCGCAACATAATCGTTTCGAA
GGATTGGCACTGGCCTGGAACTTTTATGGATGTCGCTGTCATAGAACTGA
CCAACCGCCTGCGTGGCAATCGGAATAACTATGTTACCCTCTGTACCAAT
CCGCTGAGCTCGTACAAAAGCCTTTCCGTTGTGTCCTACGGCGCAGGACC
CGCGGAAAACGTACGAACAGAAGAAATTGAGGTGCTCAACCGAATGATCT
GCGATTCGGCGTACGGCAATTTTCTTCTGCGCGAAACTGTCGCCTGTGCC
AAGGAATTTAAAAGGAGCGCAGACTGTATGTTTAGCGCCGGATGTCCTGT
GACTGCTGGAGATCAGCTTTGTGGTATCGTCGCCTGGAGTCCCGCCTGCA
AGAGATCCAATTTACCAGGGATCTTCACCGATATCCATCAGGTTAAACGA
TTCATTCTGAAGGCGATCAGTGGAAAGCATAAGGGCACTAGCCATCCAAA
AACGGAACGGGCATCAGATAACGTACCCGAGTGGCACTCGGGTCTCTGGC
TAAGTCGTTAAGCTCATTGTGTGCATCCATGTCTTTTACTATTATGCTAT
TAAAGTTCATTTTGGGAATACCCTAAAAAAAAAAAAAAAAAA

IP19836.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34130-RA 976 CG34130-RA 3..976 1..974 4870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22012040..22013013 974..1 4855 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26189003..26189977 975..1 4875 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25929834..25930808 975..1 4875 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:19:13 has no hits.

IP19836.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:58 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22012040..22013013 1..974 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:22 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..894 18..911 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:37 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..894 18..911 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:55 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..894 18..911 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:52 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..894 18..911 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:16:24 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..894 18..911 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:15:38 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..894 18..911 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:37 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..974 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:55 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..974 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:52 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..894 18..911 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:16:24 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34130-RA 1..974 1..974 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:58 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26189004..26189977 1..974 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:58 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26189004..26189977 1..974 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:58 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26189004..26189977 1..974 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:55 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22014726..22015699 1..974 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:31 Download gff for IP19836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25929835..25930808 1..974 100   Minus

IP19836.pep Sequence

Translation from 17 to 910

> IP19836.pep
MKYIREIFSIALLLTEVGAAHSSWWNSSASYLHGRPPVRTLNKNGIRRTS
GGHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVEL
VSSDSRQDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRG
NRNNYVTLCTNPLSSYKSLSVVSYGAGPAENVRTEEIEVLNRMICDSAYG
NFLLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAWSPACKRSNLP
GIFTDIHQVKRFILKAISGKHKGTSHPKTERASDNVPEWHSGLWLSR*

IP19836.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16039-PA 531 GF16039-PA 284..518 28..270 628 49.2 Plus
Dana\GF16039-PA 531 GF16039-PA 43..273 45..274 326 32.4 Plus
Dana\GF18952-PA 571 GF18952-PA 272..533 4..263 324 28.5 Plus
Dana\GF18952-PA 571 GF18952-PA 15..261 24..264 313 31.4 Plus
Dana\GF10197-PA 277 GF10197-PA 71..266 67..263 212 27.5 Plus
Dana\GF10198-PA 272 GF10198-PA 37..268 35..267 206 25 Plus
Dana\GF10196-PA 263 GF10196-PA 29..263 35..273 205 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12195-PA 526 GG12195-PA 260..526 30..297 1176 81.3 Plus
Dere\GG11469-PA 314 GG11469-PA 43..277 45..275 276 27.5 Plus
Dere\GG12195-PA 526 GG12195-PA 43..262 45..263 264 26.3 Plus
Dere\GG13274-PA 273 GG13274-PA 58..268 57..268 245 30.1 Plus
Dere\GG23011-PA 246 GG23011-PA 46..244 66..267 211 29.5 Plus
Dere\GG13273-PA 292 GG13273-PA 86..285 67..267 208 28.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18182-PA 243 GH18182-PA 3..242 47..289 234 26.6 Plus
Dgri\GH15252-PA 261 GH15252-PA 29..260 42..268 208 26.4 Plus
Dgri\GH15251-PA 253 GH15251-PA 13..244 40..263 203 26.4 Plus
Dgri\GH15562-PA 274 GH15562-PA 63..268 67..268 157 25.2 Plus
Dgri\GH20776-PA 378 GH20776-PA 128..360 44..263 156 23.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34130-PA 297 CG34130-PA 1..297 1..297 1582 100 Plus
CG34129-PA 314 CG34129-PA 43..261 45..263 287 28.6 Plus
Sems-PA 275 CG10586-PA 37..267 36..267 236 27.6 Plus
CG11037-PA 292 CG11037-PA 61..285 48..267 211 26.6 Plus
CG3650-PA 249 CG3650-PA 49..247 66..267 210 29.5 Plus
CG33159-PA 257 CG33159-PA 37..248 55..263 197 27.8 Plus
CG10587-PA 276 CG10587-PA 70..269 67..267 196 27.4 Plus
CG32271-PA 248 CG32271-PA 35..246 54..267 185 24.4 Plus
CG10587-PC 289 CG10587-PC 70..282 67..267 184 26.7 Plus
CG18735-PA 364 CG18735-PA 76..304 42..256 179 24.7 Plus
CG17239-PB 248 CG17239-PB 34..241 54..267 177 25.2 Plus
CG17239-PA 248 CG17239-PA 34..241 54..267 177 25.2 Plus
CG4386-PA 372 CG4386-PA 136..354 53..263 163 22.7 Plus
thetaTry-PA 262 CG12385-PA 42..258 49..266 159 23.1 Plus
iotaTry-PA 252 CG7754-PA 40..248 56..266 153 24.1 Plus
Ser8-PA 260 CG4812-PA 47..256 56..266 151 22.3 Plus
CG17571-PB 258 CG17571-PB 57..252 69..264 148 22.8 Plus
CG17571-PA 258 CG17571-PA 57..252 69..264 148 22.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16933-PA 276 GI16933-PA 37..273 44..276 224 25.4 Plus
Dmoj\GI11960-PA 250 GI11960-PA 32..243 55..263 199 27.4 Plus
Dmoj\GI11961-PA 263 GI11961-PA 48..262 53..268 199 24.6 Plus
Dmoj\GI17437-PA 238 GI17437-PA 13..232 44..264 175 23.8 Plus
Dmoj\GI16837-PA 287 GI16837-PA 77..282 66..267 174 25.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22003-PA 295 GL22003-PA 31..271 28..271 498 42 Plus
Dper\GL25243-PA 261 GL25243-PA 49..260 55..268 201 25.9 Plus
Dper\GL26259-PA 274 GL26259-PA 68..268 67..268 198 27.4 Plus
Dper\GL25242-PA 254 GL25242-PA 34..240 55..260 175 26.5 Plus
Dper\GL23874-PA 258 GL23874-PA 53..249 67..263 159 23.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27342-PA 295 GA27342-PA 31..269 28..269 499 42.3 Plus
Dpse\GA17587-PA 255 GA17587-PA 44..253 51..267 222 29.5 Plus
Dpse\GA16803-PA 257 GA16803-PA 45..256 55..268 200 25.9 Plus
Dpse\GA10417-PA 274 GA10417-PA 68..268 67..268 198 27.4 Plus
Dpse\GA18452-PA 258 GA18452-PA 53..249 67..263 159 23.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10192-PA 550 GM10192-PA 271..550 16..297 1369 90.8 Plus
Dsec\GM10192-PA 550 GM10192-PA 43..261 45..263 296 29.1 Plus
Dsec\GM22176-PA 278 GM22176-PA 37..267 36..267 258 28.5 Plus
Dsec\GM22175-PA 276 GM22175-PA 70..270 67..268 210 27.3 Plus
Dsec\GM11905-PA 249 GM11905-PA 47..247 63..267 209 27.8 Plus
Dsec\GM14070-PA 256 GM14070-PA 37..252 55..267 205 27.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\BG642287-PA 317 GD18143-PA 43..261 45..263 296 29.1 Plus
Dsim\GD17559-PA 278 GD17559-PA 37..267 36..267 259 28 Plus
Dsim\GD12154-PA 292 GD12154-PA 61..285 48..267 220 27 Plus
Dsim\GD11903-PA 249 GD11903-PA 47..247 63..267 210 29.6 Plus
Dsim\GD12153-PA 276 GD12153-PA 70..270 67..268 207 26.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23354-PA 376 GJ23354-PA 126..370 18..278 544 41.2 Plus
Dvir\GJ23353-PA 757 GJ23353-PA 50..263 57..273 209 26.2 Plus
Dvir\GJ12183-PA 250 GJ12183-PA 32..248 55..268 195 25.3 Plus
Dvir\GJ12185-PA 243 GJ12185-PA 10..241 39..267 190 23 Plus
Dvir\GJ24492-PA 257 GJ24492-PA 41..253 50..268 186 25.6 Plus
Dvir\GJ23353-PA 757 GJ23353-PA 591..735 135..273 160 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13317-PA 291 GK13317-PA 12..273 2..270 571 40.4 Plus
Dwil\GK13475-PA 251 GK13475-PA 45..246 67..268 229 28.4 Plus
Dwil\GK19136-PA 252 GK19136-PA 39..250 54..267 219 27.1 Plus
Dwil\GK21642-PA 254 GK21642-PA 45..252 57..267 203 24.9 Plus
Dwil\GK19135-PA 263 GK19135-PA 44..252 55..262 203 26.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10637-PA 540 GE10637-PA 270..540 27..297 1155 78.2 Plus
Dyak\GE10637-PA 540 GE10637-PA 43..262 45..263 286 28.5 Plus
Dyak\GE23660-PA 298 GE23660-PA 6..258 10..263 264 25.1 Plus
Dyak\GE22728-PA 273 GE22728-PA 46..268 45..268 231 27.7 Plus
Dyak\GE22370-PA 273 GE22370-PA 46..268 45..268 228 27.7 Plus
Dyak\GE22726-PA 276 GE22726-PA 52..270 49..268 219 26.9 Plus

IP19836.hyp Sequence

Translation from 17 to 910

> IP19836.hyp
MKYIREIFSIALLLTEVGAAHSSWWNSSASYLHGRPPVRTLNKNGIRRTS
GGHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVEL
VSSDSRQDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRG
NRNNYVTLCTNPLSSYKSLSVVSYGAGPAENVRTEEIEVLNRMICDSAYG
NFLLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAWSPACKRSNLP
GIFTDIHQVKRFILKAISGKHKGTSHPKTERASDNVPEWHSGLWLSR*

IP19836.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG34130-PA 297 CG34130-PA 1..297 1..297 1582 100 Plus
CG34129-PA 314 CG34129-PA 43..261 45..263 287 28.6 Plus
Sems-PA 275 CG10586-PA 37..267 36..267 236 27.6 Plus
CG11037-PA 292 CG11037-PA 61..285 48..267 211 26.6 Plus
CG3650-PA 249 CG3650-PA 49..247 66..267 210 29.5 Plus