BDGP Sequence Production Resources |
Search the DGRC for IP19837
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 198 |
Well: | 37 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34001-RB |
Protein status: | IP19837.pep: gold |
Sequenced Size: | 582 |
Gene | Date | Evidence |
---|---|---|
CG34001 | 2008-04-29 | Release 5.5 accounting |
CG34001 | 2008-05-05 | Release 5.5 slip selected |
CG34001 | 2008-08-15 | Release 5.9 accounting |
hay | 2008-08-15 | Release 5.9 accounting |
CG34001 | 2008-12-18 | 5.12 accounting |
hay | 2008-12-18 | 5.12 accounting |
582 bp assembled on 2008-05-14
GenBank Submission: BT030911
> IP19837.complete ACGAAAGCGGCTTTAGGCGCTCGTCTGTGTTTATACGTGATTTACCAACT ATTTGCATTTCAAAATACAAAAACAGGATGCCCATTGTAGTAAAAACACA AAACGCTGGCAAAGGCGATTGGGCCATTATAGAGCTGCAAGGCGACCTGG AGGTGCGGAGCAACCAGGATATGCACGGCCAGTTTATTGGCGATCTCTAC TACAATAAATATGGCCAACCTATTCTCATCATTGGACATCACATTCTTCA GGGACGTGAACAAAAGTTGGATAAACCATTTGCGGTGCTGGAAAAGTCCA AGACCAATGAGGGAGAACGACTCCTAGAAACGAGCATGGCCTCGCAGGAT GTCAGTATGCTGAACGCCACCACGGGAGCGGAGCGCACAGTGCTGGATCA TACGATCGCCCAGGAGCACAAGAGTCGCCAAAGAACGGAGTACACTGTGC GCGCCGTTTGCACCAAAAAATTAATCTTCAAATCGCGACCCAAACCAATT ATAGCCAATGTAGCTAAATCCGTTTAGGTGTGTTTTCAAAAATATAGTTT TATTCAATTTGTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 10625667..10626007 | 222..562 | 1690 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 10625475..10625598 | 98..221 | 620 | 100 | Plus |
chr3L | 24539361 | chr3L | 10622487..10622583 | 1..97 | 470 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 10622487..10622583 | 1..97 | 98 | -> | Plus |
chr3L | 10625475..10625598 | 98..221 | 100 | -> | Plus |
chr3L | 10625667..10626007 | 222..562 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RA | 1..429 | 99..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RB | 1..450 | 78..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RB | 1..450 | 78..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RA | 1..429 | 99..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RB | 1..450 | 78..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RA | 1..430 | 98..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RB | 1..562 | 1..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RB | 21..582 | 1..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RA | 1..430 | 98..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34001-RB | 21..582 | 1..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10631099..10631195 | 1..97 | 100 | -> | Plus |
3L | 10634075..10634198 | 98..221 | 100 | -> | Plus |
3L | 10634267..10634607 | 222..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10631099..10631195 | 1..97 | 100 | -> | Plus |
3L | 10634075..10634198 | 98..221 | 100 | -> | Plus |
3L | 10634267..10634607 | 222..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10631099..10631195 | 1..97 | 100 | -> | Plus |
3L | 10634075..10634198 | 98..221 | 100 | -> | Plus |
3L | 10634267..10634607 | 222..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 10627367..10627707 | 222..562 | 100 | Plus | |
arm_3L | 10624199..10624295 | 1..97 | 100 | -> | Plus |
arm_3L | 10627175..10627298 | 98..221 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10624199..10624295 | 1..97 | 100 | -> | Plus |
3L | 10627175..10627298 | 98..221 | 100 | -> | Plus |
3L | 10627367..10627707 | 222..562 | 100 | Plus |
Translation from 2 to 526
> IP19837.pep ESGFRRSSVFIRDLPTICISKYKNRMPIVVKTQNAGKGDWAIIELQGDLE VRSNQDMHGQFIGDLYYNKYGQPILIIGHHILQGREQKLDKPFAVLEKSK TNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVR AVCTKKLIFKSRPKPIIANVAKSV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20124-PA | 142 | GF20124-PA | 1..142 | 33..174 | 708 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15441-PA | 142 | GG15441-PA | 1..142 | 33..174 | 750 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14951-PA | 118 | GH14951-PA | 1..118 | 57..174 | 498 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34001-PB | 149 | CG34001-PB | 1..149 | 26..174 | 762 | 100 | Plus |
CG34001-PC | 139 | CG34001-PC | 1..139 | 26..174 | 690 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11478-PA | 118 | GI11478-PA | 1..118 | 57..174 | 529 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15472-PA | 154 | GL15472-PA | 13..154 | 33..174 | 708 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23833-PA | 142 | GA23833-PA | 1..142 | 33..174 | 707 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25216-PA | 142 | GM25216-PA | 1..142 | 33..174 | 754 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14249-PA | 142 | GD14249-PA | 1..142 | 33..174 | 754 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13671-PA | 142 | GJ13671-PA | 2..142 | 34..174 | 642 | 83.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12274-PA | 119 | GK12274-PA | 1..119 | 57..174 | 544 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21751-PA | 147 | GE21751-PA | 5..147 | 33..174 | 734 | 97.2 | Plus |
Translation from 2 to 526
> IP19837.hyp ESGFRRSSVFIRDLPTICISKYKNRMPIVVKTQNAGKGDWAIIELQGDLE VRSNQDMHGQFIGDLYYNKYGQPILIIGHHILQGREQKLDKPFAVLEKSK TNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVR AVCTKKLIFKSRPKPIIANVAKSV*