Clone IP19837 Report

Search the DGRC for IP19837

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:37
Vector:pOT2
Associated Gene/TranscriptCG34001-RB
Protein status:IP19837.pep: gold
Sequenced Size:582

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34001 2008-04-29 Release 5.5 accounting
CG34001 2008-05-05 Release 5.5 slip selected
CG34001 2008-08-15 Release 5.9 accounting
hay 2008-08-15 Release 5.9 accounting
CG34001 2008-12-18 5.12 accounting
hay 2008-12-18 5.12 accounting

Clone Sequence Records

IP19837.complete Sequence

582 bp assembled on 2008-05-14

GenBank Submission: BT030911

> IP19837.complete
ACGAAAGCGGCTTTAGGCGCTCGTCTGTGTTTATACGTGATTTACCAACT
ATTTGCATTTCAAAATACAAAAACAGGATGCCCATTGTAGTAAAAACACA
AAACGCTGGCAAAGGCGATTGGGCCATTATAGAGCTGCAAGGCGACCTGG
AGGTGCGGAGCAACCAGGATATGCACGGCCAGTTTATTGGCGATCTCTAC
TACAATAAATATGGCCAACCTATTCTCATCATTGGACATCACATTCTTCA
GGGACGTGAACAAAAGTTGGATAAACCATTTGCGGTGCTGGAAAAGTCCA
AGACCAATGAGGGAGAACGACTCCTAGAAACGAGCATGGCCTCGCAGGAT
GTCAGTATGCTGAACGCCACCACGGGAGCGGAGCGCACAGTGCTGGATCA
TACGATCGCCCAGGAGCACAAGAGTCGCCAAAGAACGGAGTACACTGTGC
GCGCCGTTTGCACCAAAAAATTAATCTTCAAATCGCGACCCAAACCAATT
ATAGCCAATGTAGCTAAATCCGTTTAGGTGTGTTTTCAAAAATATAGTTT
TATTCAATTTGTAAAAAAAAAAAAAAAAAAAA

IP19837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34001-RB 567 CG34001-RB 1..563 1..563 2815 100 Plus
hay-RA 2597 hay-RA 1..91 7..97 455 100 Plus
E(z)-RB 2526 E(z)-RB 2476..2526 563..513 255 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10625667..10626007 222..562 1690 99.7 Plus
chr3L 24539361 chr3L 10625475..10625598 98..221 620 100 Plus
chr3L 24539361 chr3L 10622487..10622583 1..97 470 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10634267..10634608 222..563 1710 100 Plus
3L 28110227 3L 10634075..10634198 98..221 620 100 Plus
3L 28110227 3L 10631099..10631195 1..97 485 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10627367..10627708 222..563 1710 100 Plus
3L 28103327 3L 10627175..10627298 98..221 620 100 Plus
3L 28103327 3L 10624199..10624295 1..97 485 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:55:12 has no hits.

IP19837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:56:02 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10622487..10622583 1..97 98 -> Plus
chr3L 10625475..10625598 98..221 100 -> Plus
chr3L 10625667..10626007 222..562 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:23 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RA 1..429 99..527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:52:01 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RB 1..450 78..527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:52:18 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RB 1..450 78..527 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:51:12 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RA 1..429 99..527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:17:20 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RB 1..450 78..527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:14:55 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RA 1..430 98..527 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:52:00 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RB 1..562 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:52:18 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RB 21..582 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:51:12 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RA 1..430 98..527 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:17:20 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
CG34001-RB 21..582 1..562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:56:02 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10631099..10631195 1..97 100 -> Plus
3L 10634075..10634198 98..221 100 -> Plus
3L 10634267..10634607 222..562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:56:02 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10631099..10631195 1..97 100 -> Plus
3L 10634075..10634198 98..221 100 -> Plus
3L 10634267..10634607 222..562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:56:02 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10631099..10631195 1..97 100 -> Plus
3L 10634075..10634198 98..221 100 -> Plus
3L 10634267..10634607 222..562 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:52:18 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10627367..10627707 222..562 100   Plus
arm_3L 10624199..10624295 1..97 100 -> Plus
arm_3L 10627175..10627298 98..221 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:03 Download gff for IP19837.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10624199..10624295 1..97 100 -> Plus
3L 10627175..10627298 98..221 100 -> Plus
3L 10627367..10627707 222..562 100   Plus

IP19837.pep Sequence

Translation from 2 to 526

> IP19837.pep
ESGFRRSSVFIRDLPTICISKYKNRMPIVVKTQNAGKGDWAIIELQGDLE
VRSNQDMHGQFIGDLYYNKYGQPILIIGHHILQGREQKLDKPFAVLEKSK
TNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVR
AVCTKKLIFKSRPKPIIANVAKSV*

IP19837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20124-PA 142 GF20124-PA 1..142 33..174 708 90.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15441-PA 142 GG15441-PA 1..142 33..174 750 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14951-PA 118 GH14951-PA 1..118 57..174 498 84.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34001-PB 149 CG34001-PB 1..149 26..174 762 100 Plus
CG34001-PC 139 CG34001-PC 1..139 26..174 690 93.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11478-PA 118 GI11478-PA 1..118 57..174 529 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15472-PA 154 GL15472-PA 13..154 33..174 708 90.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23833-PA 142 GA23833-PA 1..142 33..174 707 90.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25216-PA 142 GM25216-PA 1..142 33..174 754 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14249-PA 142 GD14249-PA 1..142 33..174 754 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13671-PA 142 GJ13671-PA 2..142 34..174 642 83.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12274-PA 119 GK12274-PA 1..119 57..174 544 86.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21751-PA 147 GE21751-PA 5..147 33..174 734 97.2 Plus

IP19837.hyp Sequence

Translation from 2 to 526

> IP19837.hyp
ESGFRRSSVFIRDLPTICISKYKNRMPIVVKTQNAGKGDWAIIELQGDLE
VRSNQDMHGQFIGDLYYNKYGQPILIIGHHILQGREQKLDKPFAVLEKSK
TNEGERLLETSMASQDVSMLNATTGAERTVLDHTIAQEHKSRQRTEYTVR
AVCTKKLIFKSRPKPIIANVAKSV*

IP19837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34001-PB 149 CG34001-PB 1..149 26..174 762 100 Plus
CG34001-PC 139 CG34001-PC 1..139 26..174 690 93.3 Plus