Clone IP19839 Report

Search the DGRC for IP19839

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:39
Vector:pOT2
Associated Gene/TranscriptSIFa-RB
Protein status:IP19839.pep: gold
Sequenced Size:524

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
IFa 2008-05-05 Release 5.5 slip selected
IFa 2008-08-15 Release 5.9 accounting
IFa 2008-12-18 5.12 accounting

Clone Sequence Records

IP19839.complete Sequence

524 bp assembled on 2008-05-22

GenBank Submission: BT032699

> IP19839.complete
CCGGTTTCTAACACAGCTCAGACCTTCCTTCCTTTCACTGCCCACAACGC
TCACCGAAAACTGCAAGATGGCTCTTCGATTCACACTCACTCTGCTCCTG
GTCACGATCCTGGTCGCAGCCATACTTTTGGGCTCCAGTGAGGCAGCCTA
CAGGAAGCCTCCGTTCAACGGCAGCATCTTCGGCAAACGCAACAGCCTAG
ACTACGACAGCGCCAAAATGAGCGCCGTTTGCGAGGTGGCCATGGAGGCG
TGTCCCATGTGGTTTCCCCAGAACGACAGCAAATAGGACCACGCCCTGCG
ACTCCGCCTCCAAGAACTGATCTCGAGCCTACGACTAACACACCAGCGAC
AGGTGGGCAGATGCTGTGCCTGCTCGTGCGACTGAATGTGGAAATGCCGG
ACGTTAAAAAAGTCATGTATAAAATTTATAATGTAAGCCGTGCATATAGG
TACATAGAACTTATGCCATACATATACATAAAATACTCAATAAACTTACA
GCACTGAAAAAAAAAAAAAAAAAA

IP19839.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
IFa.a 614 IFa.a 99..606 1..508 2540 100 Plus
IFa-RA 561 IFa-RA 252..561 199..508 1550 100 Plus
IFa-RA 561 IFa-RA 2..201 1..200 1000 100 Plus
Start1.b 2246 Start1.b 2082..2246 508..344 825 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20463496..20463803 506..199 1525 99.7 Minus
chr2R 21145070 chr2R 20463854..20464053 200..1 1000 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:39:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24577574..24577883 508..199 1550 100 Minus
2R 25286936 2R 24577934..24578133 200..1 1000 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24578773..24579082 508..199 1550 100 Minus
2R 25260384 2R 24579133..24579332 200..1 1000 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:49:22 has no hits.

IP19839.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:50:21 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20463854..20464053 1..200 100   Minus
chr2R 20463496..20463801 201..506 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:27 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RA 1..133 68..200 100 -> Plus
IFa-RA 186..491 201..506 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:38:18 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RA 1..133 68..200 100 -> Plus
IFa-RA 186..491 201..506 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:23:57 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RB 1..219 68..286 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:44:08 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RA 1..133 68..200 100 -> Plus
IFa-RA 186..491 201..506 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:43:58 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
SIFa-RB 1..219 68..286 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:07:34 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RA 2..201 1..200 100 -> Plus
IFa-RA 254..559 201..506 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:38:18 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RB 2..507 1..506 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:57 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RB 11..516 1..506 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:44:09 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
IFa-RA 2..201 1..200 100 -> Plus
IFa-RA 254..559 201..506 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:43:58 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
SIFa-RB 11..516 1..506 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:21 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24577576..24577881 201..506 100 <- Minus
2R 24577934..24578133 1..200 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:21 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24577576..24577881 201..506 100 <- Minus
2R 24577934..24578133 1..200 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:21 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24577576..24577881 201..506 100 <- Minus
2R 24577934..24578133 1..200 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:57 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20465099..20465404 201..506 100 <- Minus
arm_2R 20465457..20465656 1..200 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:20:58 Download gff for IP19839.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24578793..24579098 201..506 100 <- Minus
2R 24579151..24579350 1..200 100   Minus

IP19839.hyp Sequence

Translation from 0 to 285

> IP19839.hyp
RFLTQLRPSFLSLPTTLTENCKMALRFTLTLLLVTILVAAILLGSSEAAY
RKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK*

IP19839.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-PB 72 CG33527-PB 1..72 23..94 367 100 Plus

IP19839.pep Sequence

Translation from 1 to 285

> IP19839.pep
RFLTQLRPSFLSLPTTLTENCKMALRFTLTLLLVTILVAAILLGSSEAAY
RKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK*

IP19839.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11241-PA 72 GF11241-PA 1..72 23..94 376 98.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19915-PA 72 GG19915-PA 1..72 23..94 369 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21891-PA 74 GH21891-PA 3..74 24..94 307 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
SIFa-PB 72 CG33527-PB 1..72 23..94 367 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20389-PA 74 GI20389-PA 3..74 24..94 324 88.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25079-PB 72 GA25079-PB 18..72 40..94 284 94.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11817-PA 72 GM11817-PA 1..72 23..94 378 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24940-PA 72 GD24940-PA 1..72 23..94 378 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22115-PA 74 GJ22115-PA 3..74 24..94 314 86.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18403-PA 76 GK18403-PA 1..76 23..94 271 76.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11439-PA 72 GE11439-PA 1..72 23..94 374 98.6 Plus