BDGP Sequence Production Resources |
Search the DGRC for IP19839
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 198 |
Well: | 39 |
Vector: | pOT2 |
Associated Gene/Transcript | SIFa-RB |
Protein status: | IP19839.pep: gold |
Sequenced Size: | 524 |
Gene | Date | Evidence |
---|---|---|
IFa | 2008-05-05 | Release 5.5 slip selected |
IFa | 2008-08-15 | Release 5.9 accounting |
IFa | 2008-12-18 | 5.12 accounting |
524 bp assembled on 2008-05-22
GenBank Submission: BT032699
> IP19839.complete CCGGTTTCTAACACAGCTCAGACCTTCCTTCCTTTCACTGCCCACAACGC TCACCGAAAACTGCAAGATGGCTCTTCGATTCACACTCACTCTGCTCCTG GTCACGATCCTGGTCGCAGCCATACTTTTGGGCTCCAGTGAGGCAGCCTA CAGGAAGCCTCCGTTCAACGGCAGCATCTTCGGCAAACGCAACAGCCTAG ACTACGACAGCGCCAAAATGAGCGCCGTTTGCGAGGTGGCCATGGAGGCG TGTCCCATGTGGTTTCCCCAGAACGACAGCAAATAGGACCACGCCCTGCG ACTCCGCCTCCAAGAACTGATCTCGAGCCTACGACTAACACACCAGCGAC AGGTGGGCAGATGCTGTGCCTGCTCGTGCGACTGAATGTGGAAATGCCGG ACGTTAAAAAAGTCATGTATAAAATTTATAATGTAAGCCGTGCATATAGG TACATAGAACTTATGCCATACATATACATAAAATACTCAATAAACTTACA GCACTGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IFa.a | 614 | IFa.a | 99..606 | 1..508 | 2540 | 100 | Plus |
IFa-RA | 561 | IFa-RA | 252..561 | 199..508 | 1550 | 100 | Plus |
IFa-RA | 561 | IFa-RA | 2..201 | 1..200 | 1000 | 100 | Plus |
Start1.b | 2246 | Start1.b | 2082..2246 | 508..344 | 825 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 20463854..20464053 | 1..200 | 100 | Minus | |
chr2R | 20463496..20463801 | 201..506 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RA | 1..133 | 68..200 | 100 | -> | Plus |
IFa-RA | 186..491 | 201..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RA | 1..133 | 68..200 | 100 | -> | Plus |
IFa-RA | 186..491 | 201..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RB | 1..219 | 68..286 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RA | 1..133 | 68..200 | 100 | -> | Plus |
IFa-RA | 186..491 | 201..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SIFa-RB | 1..219 | 68..286 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RA | 2..201 | 1..200 | 100 | -> | Plus |
IFa-RA | 254..559 | 201..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RB | 2..507 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RB | 11..516 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IFa-RA | 2..201 | 1..200 | 100 | -> | Plus |
IFa-RA | 254..559 | 201..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
SIFa-RB | 11..516 | 1..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24577576..24577881 | 201..506 | 100 | <- | Minus |
2R | 24577934..24578133 | 1..200 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24577576..24577881 | 201..506 | 100 | <- | Minus |
2R | 24577934..24578133 | 1..200 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24577576..24577881 | 201..506 | 100 | <- | Minus |
2R | 24577934..24578133 | 1..200 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 20465099..20465404 | 201..506 | 100 | <- | Minus |
arm_2R | 20465457..20465656 | 1..200 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24578793..24579098 | 201..506 | 100 | <- | Minus |
2R | 24579151..24579350 | 1..200 | 100 | Minus |
Translation from 0 to 285
> IP19839.hyp RFLTQLRPSFLSLPTTLTENCKMALRFTLTLLLVTILVAAILLGSSEAAY RKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SIFa-PB | 72 | CG33527-PB | 1..72 | 23..94 | 367 | 100 | Plus |
Translation from 1 to 285
> IP19839.pep RFLTQLRPSFLSLPTTLTENCKMALRFTLTLLLVTILVAAILLGSSEAAY RKPPFNGSIFGKRNSLDYDSAKMSAVCEVAMEACPMWFPQNDSK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11241-PA | 72 | GF11241-PA | 1..72 | 23..94 | 376 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19915-PA | 72 | GG19915-PA | 1..72 | 23..94 | 369 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21891-PA | 74 | GH21891-PA | 3..74 | 24..94 | 307 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
SIFa-PB | 72 | CG33527-PB | 1..72 | 23..94 | 367 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20389-PA | 74 | GI20389-PA | 3..74 | 24..94 | 324 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25079-PB | 72 | GA25079-PB | 18..72 | 40..94 | 284 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11817-PA | 72 | GM11817-PA | 1..72 | 23..94 | 378 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24940-PA | 72 | GD24940-PA | 1..72 | 23..94 | 378 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22115-PA | 74 | GJ22115-PA | 3..74 | 24..94 | 314 | 86.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18403-PA | 76 | GK18403-PA | 1..76 | 23..94 | 271 | 76.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11439-PA | 72 | GE11439-PA | 1..72 | 23..94 | 374 | 98.6 | Plus |