Clone IP19864 Report

Search the DGRC for IP19864

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:198
Well:64
Vector:pOT2
Associated Gene/TranscriptCG31220-RB
Protein status:IP19864.pep: gold
Sequenced Size:1379

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31220 2008-04-29 Release 5.5 accounting
CG31220 2008-05-05 Release 5.5 slip selected
CG31220 2008-08-15 Release 5.9 accounting
CG31220 2008-12-18 5.12 accounting

Clone Sequence Records

IP19864.complete Sequence

1379 bp assembled on 2008-05-14

GenBank Submission: BT030920

> IP19864.complete
TTAAAGCAGTTTGTTGTCTAAAGCTAAAAAAATCATAAATTAAGGAATAT
ATTTAACCAAAAATCTTTGCCAGCGGAGTTATTTTATCAAGCTTAACGTG
TAGTCTATAGGATTATCTATGATTCCCGTTACTCACACTCGCAGGCAGCA
AAGCGAACGTTTTCTAAAGTGCACACAGGCTCCACCTAGCGAAGCTTGAC
AGCCGACAACTGATGTGTGCACGCAAGCGGACGGAGGGCAATCTTTGCCG
TCGCCATAAAAGTGGCTGCAGTGCAAACCAATATAAACTGTGTGAACCGG
ATGAGGAGTGCATCCGACTTAAGGATTGCCGACCCATATATTACAATGTG
AGGAGAAACAGATTGTCGGGGTCCGCAAAAGTGAATATATCGCAGACAAG
AATGTGTGGCGTGAGTGTTCGAGACCGGAAACGTTACAAAAGGATTTATA
TCTGCTGTCCCAAGCCGGCAAACACCTTGCCAAGCTATCCGGATTGTGGG
AAGCCACAAACGACTAACCGTGTTATAGGCGGCACGGAGCCGAATCTCAA
CGAATATCCGTGGCTGGCCATGCTTCTATATCGAAATCGTAGTGCCTTCA
ACCCGGATCGGGAGCTAGTCCCCAGTTGTGGTGGCTCCCTGATTAACACT
CGCTATGTCCTGACCGCAGCCCACTGTGTAACCGATACGGTCTTGCAAAT
CCAACGCGTCCGCCTGGGCGAGCACACAACGTCCCATAACCCGGACTGCA
TCAGCCGGGGCGCACGAATCGTTTGCGCTCCCACACATCTGGACATCGAC
GTGGAGTCGATCACATCGCATAATGACTACGATCCAGCCAATTACACCTT
TCGGAACGACATCGCCCTGGTGCGACTCAAAGAGCCAGTGCGATATACGA
TGGCTTACTATCCGATTTGCGTTCTGGACTACCCAAGGTCACTGATGAAA
TTCAAGATGTACGTGGCTGGATGGGGAAAAACGGGCATGTTCGACACTGG
GAGCAAGGTGCTGAAACACGCTGCCGTCAAGGTAAGGAAACCAGAAGAGT
GCTCGGAAAAGTACGCACACCGGCATTTCGGGCCCAGATTCCAGATATGC
GCCGGCGGCTTGGATAACCGGGGCACCTGCGACGGCGACTCCGGCAGTCC
ATTGATGGGCACATCGGGTCGCAGCTACGAGACAATCACGTTCCTGGCCG
GCATCACTTCATACGGAGGTCCTTGCGGCACGATTGGCTGGCCGAGTGTT
TTCACACGAACGGCGAAGTTTTACAAATGGATACGGGCACACTTAAGGCC
CTAGAAACTGTTGAACATACTAATATAATGTTGACCAAATATATATACAC
CAAAATATAAAAAAAAAAAAAAAAAAAAA

IP19864.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31220-RB 1358 CG31220-RB 1..1358 1..1358 6790 100 Plus
nc_17781.a 503 nc_17781.a 154..314 122..282 805 100 Plus
nc_17781.a 503 nc_17781.a 1..90 32..121 450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15473281..15473890 283..892 2930 98.7 Plus
chr3R 27901430 chr3R 15473953..15474419 892..1358 2305 99.6 Plus
chr3R 27901430 chr3R 15472582..15472743 121..282 810 100 Plus
chr3R 27901430 chr3R 15472320..15472440 1..121 590 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:40:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19649448..19650057 283..892 3050 100 Plus
3R 32079331 3R 19650120..19650588 892..1360 2345 100 Plus
3R 32079331 3R 19648749..19648910 121..282 810 100 Plus
3R 32079331 3R 19648487..19648607 1..121 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19390279..19390888 283..892 3050 100 Plus
3R 31820162 3R 19390951..19391419 892..1360 2345 100 Plus
3R 31820162 3R 19389580..19389741 121..282 810 100 Plus
3R 31820162 3R 19389318..19389438 1..121 605 100 Plus
3R 31820162 3R 19392386..19392434 633..681 170 89.7 Plus
Blast to na_te.dros performed 2019-03-16 16:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 3309..3374 223..285 187 80.3 Plus
rover 7318 rover ROVER 7318bp 2771..2809 4..42 123 79.5 Plus

IP19864.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:52:05 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15472320..15472440 1..121 99 -> Plus
chr3R 15472583..15472743 122..282 100 -> Plus
chr3R 15473281..15473890 283..892 98 -> Plus
chr3R 15473954..15474419 893..1358 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:16:41 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RA 1..903 402..1304 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:53:11 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 1..1092 213..1304 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:09 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 1..1092 213..1304 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:52:31 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RA 1..903 402..1304 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:45:35 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 1..1092 213..1304 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:16:15 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RA 1..903 402..1304 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:53:11 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 1..1358 1..1358 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:09 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 1..1358 1..1358 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:52:31 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RA 1..903 402..1304 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:45:35 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 1..116 1..116 100 <- Plus
CG31220-RB 180..1421 117..1358 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:05 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19648487..19648607 1..121 100 -> Plus
3R 19648750..19648910 122..282 100 -> Plus
3R 19649448..19650057 283..892 100 -> Plus
3R 19650121..19650586 893..1358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:05 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19648487..19648607 1..121 100 -> Plus
3R 19648750..19648910 122..282 100 -> Plus
3R 19649448..19650057 283..892 100 -> Plus
3R 19650121..19650586 893..1358 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:52:05 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19648487..19648607 1..121 100 -> Plus
3R 19648750..19648910 122..282 100 -> Plus
3R 19649448..19650057 283..892 100 -> Plus
3R 19650121..19650586 893..1358 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:09 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15474209..15474329 1..121 100 -> Plus
arm_3R 15474472..15474632 122..282 100 -> Plus
arm_3R 15475170..15475779 283..892 100 -> Plus
arm_3R 15475843..15476308 893..1358 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:30:53 Download gff for IP19864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19389318..19389438 1..121 100 -> Plus
3R 19389581..19389741 122..282 100 -> Plus
3R 19390279..19390888 283..892 100 -> Plus
3R 19390952..19391417 893..1358 100   Plus

IP19864.hyp Sequence

Translation from 212 to 1303

> IP19864.hyp
MCARKRTEGNLCRRHKSGCSANQYKLCEPDEECIRLKDCRPIYYNVRRNR
LSGSAKVNISQTRMCGVSVRDRKRYKRIYICCPKPANTLPSYPDCGKPQT
TNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVL
TAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESI
TSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY
VAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGL
DNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRT
AKFYKWIRAHLRP*

IP19864.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG31220-PB 363 CG31220-PB 1..363 1..363 1995 100 Plus
CG16710-PB 372 CG16710-PB 25..362 22..357 619 42 Plus
CG10232-PD 509 CG10232-PD 180..509 19..363 604 41 Plus
CG31219-PB 345 CG31219-PB 25..345 27..363 577 40.6 Plus
CG18754-PB 341 CG18754-PB 30..341 27..363 565 39.1 Plus

IP19864.pep Sequence

Translation from 212 to 1303

> IP19864.pep
MCARKRTEGNLCRRHKSGCSANQYKLCEPDEECIRLKDCRPIYYNVRRNR
LSGSAKVNISQTRMCGVSVRDRKRYKRIYICCPKPANTLPSYPDCGKPQT
TNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVL
TAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESI
TSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY
VAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGL
DNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRT
AKFYKWIRAHLRP*

IP19864.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16252-PA 399 GF16252-PA 29..398 24..362 516 36.2 Plus
Dana\GF23198-PA 392 GF23198-PA 16..387 5..358 495 34.9 Plus
Dana\GF16188-PA 418 GF16188-PA 144..417 86..362 452 37.8 Plus
Dana\GF17682-PA 394 GF17682-PA 125..394 89..363 450 38.2 Plus
Dana\GF18202-PA 393 GF18202-PA 32..393 29..363 438 33.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11215-PA 345 GG11215-PA 30..345 27..363 628 40.5 Plus
Dere\GG12412-PA 311 GG12412-PA 16..311 61..363 518 42.6 Plus
Dere\GG11216-PA 400 GG11216-PA 23..400 15..363 507 34.8 Plus
Dere\GG11217-PA 407 GG11217-PA 16..406 9..362 494 33.9 Plus
Dere\GG24123-PA 302 GG24123-PA 6..293 72..361 492 39.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17456-PA 395 GH17456-PA 36..394 33..362 538 36.4 Plus
Dgri\GH14281-PA 578 GH14281-PA 233..578 33..363 512 37.7 Plus
Dgri\GH18317-PA 379 GH18317-PA 112..379 89..363 490 38.9 Plus
Dgri\GH19111-PA 344 GH19111-PA 66..344 86..363 470 38.4 Plus
Dgri\GH17229-PA 387 GH17229-PA 108..386 86..362 439 35.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG31220-PB 363 CG31220-PB 1..363 1..363 1995 100 Plus
CG16710-PB 372 CG16710-PB 25..362 22..357 619 42 Plus
CG10232-PD 509 CG10232-PD 180..509 19..363 604 41 Plus
CG31219-PB 345 CG31219-PB 25..345 27..363 577 40.6 Plus
CG18754-PB 341 CG18754-PB 30..341 27..363 565 39.1 Plus
CG8870-PA 356 CG8870-PA 26..342 27..362 549 41 Plus
CG12133-PB 340 CG12133-PB 18..318 61..358 537 38.9 Plus
CG18754-PC 296 CG18754-PC 2..296 45..363 524 38.8 Plus
ea-PA 392 CG4920-PA 47..387 33..358 504 37.6 Plus
SPE-PA 400 CG16705-PA 23..400 15..363 497 34.8 Plus
MP1-PA 390 CG1102-PA 32..389 29..362 454 33.1 Plus
MP1-PE 400 CG1102-PE 32..399 29..362 449 32.4 Plus
MP1-PC 399 CG1102-PC 32..398 29..362 447 33.1 Plus
ea-PB 261 CG4920-PB 5..256 112..358 446 42.1 Plus
Sp7-PF 391 CG3066-PF 120..391 87..363 446 38.8 Plus
Sp7-PE 391 CG3066-PE 120..391 87..363 446 38.8 Plus
Sp7-PA 391 CG3066-PA 120..391 87..363 446 38.8 Plus
CG9733-PB 417 CG9733-PB 143..416 86..362 417 36.6 Plus
CG9733-PA 418 CG9733-PA 144..417 86..362 417 36.6 Plus
CG9737-PA 424 CG9737-PA 110..406 63..357 415 35.8 Plus
CG3505-PA 360 CG3505-PA 40..359 33..362 411 34.5 Plus
CG11313-PC 367 CG11313-PC 101..367 89..363 385 36.3 Plus
CG11313-PD 370 CG11313-PD 101..370 89..363 381 36.1 Plus
grass-PA 335 CG5896-PA 68..326 94..357 347 34.7 Plus
grass-PB 377 CG5896-PB 110..368 94..357 347 34.7 Plus
Ser7-PA 397 CG2045-PA 112..393 83..362 345 32.5 Plus
CG11836-PI 281 CG11836-PI 35..274 94..361 341 31.7 Plus
CG11836-PJ 333 CG11836-PJ 87..326 94..361 341 31.7 Plus
CG17572-PA 385 CG17572-PA 69..384 27..363 328 30.4 Plus
CG1299-PB 442 CG1299-PB 105..434 33..357 324 28.8 Plus
CG1299-PA 511 CG1299-PA 174..503 33..357 324 28.8 Plus
CG18735-PA 364 CG18735-PA 74..316 95..362 320 32.5 Plus
CG32260-PC 395 CG32260-PC 126..392 83..361 320 31.7 Plus
CG32260-PA 575 CG32260-PA 306..572 83..361 320 31.7 Plus
CG4386-PA 372 CG4386-PA 118..355 95..358 317 30.4 Plus
Sb-PB 787 CG4316-PB 535..787 93..362 315 29.6 Plus
Sb-PA 787 CG4316-PA 535..787 93..362 315 29.6 Plus
CG3355-PA 314 CG3355-PA 68..303 95..358 303 33.8 Plus
CG8172-PE 545 CG8172-PE 288..536 93..357 302 34.7 Plus
CG8172-PF 561 CG8172-PF 304..552 93..357 302 34.7 Plus
CG7432-PB 721 CG7432-PB 457..720 87..362 299 30.5 Plus
CG5909-PA 381 CG5909-PA 116..381 89..362 298 30.7 Plus
CG30087-PA 277 CG30087-PA 28..271 93..358 296 33.6 Plus
CG8172-PD 371 CG8172-PD 116..362 95..357 296 34.6 Plus
CG4613-PC 374 CG4613-PC 129..367 95..362 296 31.9 Plus
CG4613-PB 374 CG4613-PB 129..367 95..362 296 31.9 Plus
CG11836-PF 223 CG11836-PF 12..216 139..361 284 32.7 Plus
CG11836-PE 223 CG11836-PE 12..216 139..361 284 32.7 Plus
CG11836-PG 223 CG11836-PG 12..216 139..361 284 32.7 Plus
CG11836-PC 223 CG11836-PC 12..216 139..361 284 32.7 Plus
CG11836-PA 223 CG11836-PA 12..216 139..361 284 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22780-PA 412 GI22780-PA 43..412 33..363 535 36.6 Plus
Dmoj\GI24877-PA 392 GI24877-PA 47..392 33..363 491 37.1 Plus
Dmoj\GI24127-PA 389 GI24127-PA 33..388 33..362 460 33.7 Plus
Dmoj\GI10853-PA 285 GI10853-PA 9..284 89..362 441 37.1 Plus
Dmoj\GI10684-PA 372 GI10684-PA 38..371 32..362 405 32.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13651-PA 382 GL13651-PA 30..381 27..362 610 40.6 Plus
Dper\GL13652-PA 401 GL13652-PA 25..400 15..362 521 34.7 Plus
Dper\GL12453-PA 383 GL12453-PA 110..383 85..363 475 39.4 Plus
Dper\GL23240-PA 395 GL23240-PA 49..395 33..363 473 35.6 Plus
Dper\GL12316-PA 391 GL12316-PA 32..391 29..363 446 34.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26978-PA 382 GA26978-PA 30..381 27..362 612 40.6 Plus
Dpse\GA14092-PA 403 GA14092-PA 36..402 24..362 519 35.3 Plus
Dpse\GA27509-PA 383 GA27509-PA 110..383 85..363 480 39.7 Plus
Dpse\GA15903-PA 383 GA15903-PA 110..383 85..363 479 39.7 Plus
Dpse\GA18526-PA 395 GA18526-PA 49..395 33..363 473 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26855-PA 367 GM26855-PA 29..367 25..363 1303 72.6 Plus
Dsec\GM26514-PA 368 GM26514-PA 29..359 27..358 596 41.6 Plus
Dsec\GM21170-PA 377 GM21170-PA 18..322 61..361 522 38.8 Plus
Dsec\GM26515-PA 296 GM26515-PA 2..296 45..363 501 37.7 Plus
Dsec\GM26516-PA 400 GM26516-PA 23..400 15..363 497 35.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19305-PA 287 GD19305-PA 3..287 79..363 1224 80 Plus
Dsim\GD21023-PA 368 GD21023-PA 29..359 27..358 587 41.6 Plus
Dsim\GD19306-PA 297 GD19306-PA 15..294 80..361 584 46.2 Plus
Dsim\GD18360-PA 332 GD18360-PA 11..332 27..363 537 38.7 Plus
Dsim\GD21024-PA 296 GD21024-PA 2..296 45..363 507 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22783-PA 401 GJ22783-PA 40..400 33..362 544 37.1 Plus
Dvir\GJ24520-PA 877 GJ24520-PA 532..876 33..362 487 36.7 Plus
Dvir\GJ10951-PA 386 GJ10951-PA 116..385 86..362 482 38.6 Plus
Dvir\GJ10404-PA 426 GJ10404-PA 151..425 86..362 434 36.5 Plus
Dvir\GJ14460-PA 396 GJ14460-PA 35..395 33..362 426 30.9 Plus
Dvir\GJ24520-PA 877 GJ24520-PA 226..500 93..357 236 32.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13188-PA 395 GK13188-PA 42..394 33..362 490 36.4 Plus
Dwil\GK11130-PA 392 GK11130-PA 47..387 33..358 477 37.3 Plus
Dwil\GK12018-PA 384 GK12018-PA 112..384 86..363 435 35.3 Plus
Dwil\GK13136-PA 412 GK13136-PA 138..411 86..362 435 37.4 Plus
Dwil\GK10951-PA 391 GK10951-PA 31..391 28..363 428 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25617-PA 310 GE25617-PA 1..310 51..363 995 61 Plus
Dyak\GE10379-PA 366 GE10379-PA 28..361 27..361 645 42.8 Plus
Dyak\GE25618-PA 298 GE25618-PA 11..298 70..363 589 44.1 Plus
Dyak\GE10381-PA 322 GE10381-PA 4..322 27..363 568 38.7 Plus
Dyak\GE10383-PA 404 GE10383-PA 32..403 24..362 499 35.4 Plus